"SLAMF9" Related Products

Recombinant Human SLAMF9, Fc-tagged

Cat.No.: SLAMF9-692H
Product Overview: The recombinant human SLAMF9-Fc fusion protein is expressed as a 445-amino acid protein consisting of Arg19 - Phe234 region of SLAMF9 (UniProt accession #Q96A28) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source: Human cells
Species: Human
Tag: Fc
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Bio-activity: Immobilized SLAMF9 interacts homophilically with SLAMF9 in a functional ELISA and inhibits anti--CD3e antibody induced IL-2 secretion by human T cells
Molecular Mass: Calculated molecular mass (kDa): 49.6; Estimated by SDS-PAGE under reducing condition (kDa): 65-75
AA Sequence: RRLWRWCGSEEVVAVLQESISLPLEIPPDEEVENIIWSSHKSLATVVPGKEGHPATIMVTNPHYQGQVSFLDPS YSLHISNLSWEDSGLYQAQVNLRTSQISTMQQYNLCVYRWLSEPQITVNFESSGEGACSMSLVCSVEKAGMDMT YSWLSRGDSTYTFHEGPVLSTSWRPGDSALSYTCRANNPISNVSSCPIPDGPFYADPNYASEKPSTAFGSTGTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity: >95% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: SLAMF9 SLAM family member 9 [ Homo sapiens ]
Official Symbol: SLAMF9
Synonyms: CD2F10; CD84H1; SF2001; CD2F-10; CD84-H1
Gene ID: 89886
mRNA Refseq: NM_033438.3
Protein Refseq: NP_254273.2
MIM: 608589
UniProt ID: Q96A28
Chromosome Location: 1q23.2
Function: receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.