Recombinant Human TGFBR2, Fc-tagged, Biotinylated TGFBR2-697H

Recombinant Human TGFBR2, Fc-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human TGFBR2, Fc-tagged, Biotinylated

Recombinant Human TGFBR2, Fc-tagged, Biotinylated

TGFBR2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : TGFBR2-697H
Product Overview : The recombinant human TGFBR2-Fc fusion protein is expressed as a 365 amino acid protein consisting of Thr23 - Asp159 region of TGFBR2 (UniProt accession #P37173) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized TGFBR2 protein binds human TGFβ1 in a functional ELISA. Blocks TGFβ1-mediated signaling activity.
Molecular Mass : Calculated molecular mass (kDa): 41.1; Estimated by SDS-PAGE under reducing condition (kDa): ~60
AA Sequence : TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENIT LETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDSSGTHTCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : TGFBR2 transforming growth factor, beta receptor II (70/80kDa) [ Homo sapiens ]
Official Symbol : TGFBR2
Synonyms : TGFBR2; transforming growth factor, beta receptor II (70/80kDa); MFS2, transforming growth factor, beta receptor II (70 80kD); TGF-beta receptor type-2; tbetaR-II; TGF-beta receptor type II; TGF-beta type II receptor; TGF-beta receptor type IIB; transforming growth factor-beta receptor type II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor II (70/80kDa) isoform 1; transforming growth factor, beta receptor II (70/80kDa) isoform 2; AAT3; FAA3; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TGFR-2; TGFbeta-RII;
Gene ID : 7048
mRNA Refseq : NM_001024847
Protein Refseq : NP_001020018
MIM : 190182
UniProt ID : P37173
Chromosome Location : 3p22
Pathway : ALK1 signaling events, organism-specific biosystem; Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem;
Function : ATP binding; SMAD binding; glycosaminoglycan binding; metal ion binding; nucleotide binding; protein binding; contributes_to protein binding; receptor activity; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta binding; transforming growth factor beta binding; transforming growth factor beta-activated receptor activity; transforming growth factor beta-activated receptor activity; transforming growth factor beta-activated receptor activity; transmembrane receptor protein serine/threonine kinase activity; type I transforming growth factor beta receptor binding; type I transforming growth factor beta receptor binding; type III transforming growth factor beta receptor binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy