"TIE1" Related Products

Expand
Expand

Recombinant Human TIE1, Fc-tagged, Biotinylated

Cat.No.: TIE1-700H
Product Overview: The recombinant human Tie1-Fc fusion is expressed as a 967 amino acid protein consisting of Ala22 - Gln759 region of Tie1 and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source: Human cells
Species: Human
Tag: Fc
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity: Interacts with Tie2 and inhibits angiopoietin/Tie2-mediated signaling activity.
Molecular Mass: Calculated molecular mass (kDa): 105.5; Estimated by SDS-PAGE under reducing condition (kDa): 110-120
AA Sequence: LSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGRFLLQLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGA GRWGPGCTKECPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGISGCRGLTFCLPDPYGC SCGSGWRGSQCQEACAPGHFGADCRLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILNMASELEFNLE TMPRINCAAAGNPFPVRGSIELRKPDGTVLLSTKAIVEPEKTTAEFEVPRLVLADSGFWECRVSTSGGQDSRRF KVNVKVPPVPLAAPRLLTKQSRQLVVSPLVSFSGDGPISTVRLHYRPQDSTMDWSTIVVDPSENVTLMNLRPK TGYSVRVQLSRPGEGGEGAWGPPTLMTTDCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGPLVGDGFLLRLWD GTRGQERRENVSSPQARTALLTGLTPGTHYQLDVQLYHCTLLGPASPPAHVLLPPSGPPAPRHLHAQALSDSEI QLTWKHPEALPGPISKYVVEVQVAGGAGDPLWIDVDRPEETSTIIRGLNASTRYLFRMRASIQGLGDWSNTVEE STLGNGLQAEGPVQESRAAEEGLDQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity: >95% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: TIE1 tyrosine kinase with immunoglobulin-like and EGF-like domains 1 [ Homo sapiens ]
Official Symbol: TIE1
Synonyms: TIE1; tyrosine kinase with immunoglobulin-like and EGF-like domains 1; TIE, tyrosine kinase with immunoglobulin and epidermal growth factor homology domains 1; tyrosine-protein kinase receptor Tie-1; JTK14; tyrosine kinase with immunoglobulin and epidermal growth factor homology domains 1; TIE;
Gene ID: 7075
mRNA Refseq: NM_001253357
Protein Refseq: NP_001240286
MIM: 600222
UniProt ID: P35590
Chromosome Location: 1p34-p33
Function: ATP binding; nucleotide binding; protein binding; protein tyrosine kinase activity; receptor activity; transmembrane receptor protein tyrosine kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.