Recombinant Human PRKCD protein, His-tagged PRKCD-357H

Recombinant Human PRKCD protein, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human PRKCD protein, His-tagged

Recombinant Human PRKCD protein, His-tagged

PRKCD Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : PRKCD-357H
Product Overview : Recombinant Human PRKCD(Met1-Asp676) fussed with His tag at C-terminal was expressed in HEK293.
Description : Protein Kinase C Delta Type (PRKCD) is a member of the AGC Ser/Thr protein kinase family of protein kinase superfamily. PKC family members phosphorylate a variety of protein targets and are known to be involved in diverse cellular signaling pathways. Each member of the PKC family has a specific expression profile and is believed to play distinct roles in cells. PRKCD serves as a major receptor for phorbol esters, a class of tumor promoters. PRKCD is involved in B cell signaling and in the regulation of growth, apoptosis, and differentiation of a variety of cell types.
Source : HEK293
Species : Human
Tag : His
AA Sequence : MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFD AHIY EGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQY FLEDVDCK QSMRSEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVW GLNKQGYKCRQC NAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMS PTFCDHCGSLLWGLVK QGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASR RSDSASSEPVGIYQGFEKKT GVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSF GKVLLGELKGRGEYFAIKALKKDV VLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTK DHLFFVMEFLNGGDLMYHIQDKGRFELY RATFYAAEIMCGLQFLHSKGIIYRDLKLDNVL LDRDGHIKIADFGMCKENIFGESRASTFCGTP DYIAPEILQGLKYTFSVDWWSFGVLLYE MLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESK DILEKLFEREPTKRLGVTGNIKIH PFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNE KARLSYSDKNLIDSMDQSAF AGFSFVNPKFEHLLEDLDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Storage : Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
Gene Name : PRKCD protein kinase C, delta [ Homo sapiens ]
Official Symbol : PRKCD
Synonyms : PRKCD; protein kinase C, delta; protein kinase C delta type; protein kinase C delta VIII; tyrosine-protein kinase PRKCD; MAY1; PKCD; nPKC-delta; MGC49908;
Gene ID : 5580
mRNA Refseq : NM_006254
Protein Refseq : NP_006245
MIM : 176977
UniProt ID : Q05655
Chromosome Location : 3p21.31
Pathway : Alpha-synuclein signaling, organism-specific biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptotic cleavage of cellular proteins, organism-specific biosystem; Apoptotic executionphase, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; Ca-dependent events, organism-specific biosystem;
Function : ATP binding; calcium-independent protein kinase C activity; enzyme activator activity; enzyme binding; insulin receptor substrate binding; metal ion binding; non-membrane spanning protein tyrosine kinase activity; nucleotide binding; protein C-terminus binding; protein binding; protein kinase activity; protein serine/threonine kinase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy