Recombinant Human SFPQ protein, GST-tagged SFPQ-856H

Recombinant Human SFPQ protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human SFPQ protein, GST-tagged

Recombinant Human SFPQ protein, GST-tagged

SFPQ Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : SFPQ-856H
Product Overview : Recombinant Human SFPQ(269 a.a. - 361 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description : Splicing factor, proline- and glutamine-rich is a protein that in humans is encoded by the SFPQ gene.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 35.97 kDa
AA Sequence : EEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRA LAEIAKAELDDTPMRGRQ
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : SFPQ splicing factor proline/glutamine-rich [ Homo sapiens ]
Official Symbol : SFPQ
Synonyms : SFPQ; splicing factor proline/glutamine-rich; splicing factor proline/glutamine rich (polypyrimidine tract binding protein associated); splicing factor, proline- and glutamine-rich; polypyrimidine tract binding protein associated; PSF; hPOMp100; 100 kDa DNA-pairing protein; PTB-associated splicing factor; PTB-associated-splicing factor; DNA-binding p52/p100 complex, 100 kDa subunit; polypyrimidine tract-binding protein-associated splicing factor; polypyrimidine tract-binding protein-associated-splicing factor; splicing factor proline/glutamine rich (polypyrimidine tract-binding protein-associated); POMP100; DKFZp547C228; DKFZp667K0521; DKFZp686K1282;
Gene ID : 6421
mRNA Refseq : NM_005066
Protein Refseq : NP_005057
MIM : 605199
UniProt ID : P23246
Chromosome Location : 1p34.3
Pathway : mRNA processing, organism-specific biosystem;
Function : DNA binding; RNA binding; nucleotide binding; protein binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy