"SFPQ" Related Products

Expand

Recombinant Human SFPQ protein, GST-tagged

Cat.No.: SFPQ-856H
Product Overview: Recombinant Human SFPQ(269 a.a. - 361 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: Splicing factor, proline- and glutamine-rich is a protein that in humans is encoded by the SFPQ gene.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 35.97 kDa
AA Sequence: EEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRA LAEIAKAELDDTPMRGRQ
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: SFPQ splicing factor proline/glutamine-rich [ Homo sapiens ]
Official Symbol: SFPQ
Synonyms: SFPQ; splicing factor proline/glutamine-rich; splicing factor proline/glutamine rich (polypyrimidine tract binding protein associated); splicing factor, proline- and glutamine-rich; polypyrimidine tract binding protein associated; PSF; hPOMp100; 100 kDa DNA-pairing protein; PTB-associated splicing factor; PTB-associated-splicing factor; DNA-binding p52/p100 complex, 100 kDa subunit; polypyrimidine tract-binding protein-associated splicing factor; polypyrimidine tract-binding protein-associated-splicing factor; splicing factor proline/glutamine rich (polypyrimidine tract-binding protein-associated); POMP100; DKFZp547C228; DKFZp667K0521; DKFZp686K1282;
Gene ID: 6421
mRNA Refseq: NM_005066
Protein Refseq: NP_005057
MIM: 605199
UniProt ID: P23246
Chromosome Location: 1p34.3
Pathway: mRNA processing, organism-specific biosystem;
Function: DNA binding; RNA binding; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.