Recombinant Human SFPQ protein, GST-tagged
Cat.No. : | SFPQ-856H |
Product Overview : | Recombinant Human SFPQ(269 a.a. - 361 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 269-361 a.a. |
Description : | Splicing factor, proline- and glutamine-rich is a protein that in humans is encoded by the SFPQ gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 35.97 kDa |
AA Sequence : | EEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRA LAEIAKAELDDTPMRGRQ |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SFPQ splicing factor proline/glutamine-rich [ Homo sapiens ] |
Official Symbol | SFPQ |
Synonyms | SFPQ; splicing factor proline/glutamine-rich; splicing factor proline/glutamine rich (polypyrimidine tract binding protein associated); splicing factor, proline- and glutamine-rich; polypyrimidine tract binding protein associated; PSF; hPOMp100; 100 kDa DNA-pairing protein; PTB-associated splicing factor; PTB-associated-splicing factor; DNA-binding p52/p100 complex, 100 kDa subunit; polypyrimidine tract-binding protein-associated splicing factor; polypyrimidine tract-binding protein-associated-splicing factor; splicing factor proline/glutamine rich (polypyrimidine tract-binding protein-associated); POMP100; DKFZp547C228; DKFZp667K0521; DKFZp686K1282; |
Gene ID | 6421 |
mRNA Refseq | NM_005066 |
Protein Refseq | NP_005057 |
MIM | 605199 |
UniProt ID | P23246 |
Chromosome Location | 1p34.3 |
Pathway | mRNA processing, organism-specific biosystem; |
Function | DNA binding; RNA binding; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
SFPQ-12471Z | Recombinant Zebrafish SFPQ | +Inquiry |
SFPQ-1992H | Recombinant Human SFPQ Protein, His (Fc)-Avi-tagged | +Inquiry |
SFPQ-15007M | Recombinant Mouse SFPQ Protein | +Inquiry |
SFPQ-789HFL | Recombinant Full Length Human SFPQ Protein, C-Flag-tagged | +Inquiry |
Sfpq-5814M | Recombinant Mouse Sfpq Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SFPQ-1911HCL | Recombinant Human SFPQ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SFPQ Products
Required fields are marked with *
My Review for All SFPQ Products
Required fields are marked with *
0
Inquiry Basket