"NPR2" Related Products

Expand

Recombinant Human NPR2 protein, GST-tagged

Cat.No.: NPR2-323H
Product Overview: Recombinant Human NPR2(1 a.a. - 1023 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene encodes natriuretic peptide receptor B, one of two integral membrane receptors for natriuretic peptides. Both NPR1 and NPR2 contain five functional domains: an extracellular ligand-binding domain, a single membrane-spanning region, and intracellularly a protein kinase homology domain, a helical hinge region involved in oligomerization, and a carboxyl-terminal guanylyl cyclase catalytic domain. The protein is the primary receptor for C-type natriuretic peptide (CNP), which upon ligand binding exhibits greatly increased guanylyl cyclase activity. Mutations in this gene are the cause of acromesomelic dysplasia Maroteaux type.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 140.5 kDa
AA Sequence: MALPSLLLLVAALAGGVRPPGARNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALGRALPVDLRFVSSELEGAC SEYLAPLSAVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLLTAGAVASGFSAKNDHYRTLVRTGPSAPKLG EFVVTLHGHFNWTARAALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVY ICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQDNRTREQAQALREAFQTVLVITYRE PPNPEYQEFQNRLLIRAREDFGVELGPSLMNLIAGCFYDGILLYAEVLNETIQEGGTREDGLRIVEKMQGRRYHG VTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIWWTGRPIPWVKGAPPSDNPPCAFDLDDPSCDK TPLSTLAIVALGTGITFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQFGNSERYHKGAGSRLTLSLRGSSYG SLMTAHGKYQIFANTGHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCP RGSLQGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAEPDDSHALYAKKLWTAPELLSGNPLPT TGMQKADVYSFGIILQEIALRSGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQLNEELVLLMERCWAQDPA ERPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRG ETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQ RHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKI HVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGERKGPPGLL
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: NPR2 natriuretic peptide receptor B/guanylate cyclase B (atrionatriuretic peptide receptor B) [ Homo sapiens ]
Official Symbol: NPR2
Synonyms: NPR2; natriuretic peptide receptor B/guanylate cyclase B (atrionatriuretic peptide receptor B); acromesomelic dysplasia, Maroteaux type , AMDM, ANPRB, NPRB; atrial natriuretic peptide receptor 2; ANPb; GUCY2B; GC-B; ANP-B; NPR-B; ANPR-B; guanylate cyclase B; atrial natriuretic peptide B-type receptor; atrial natriuretic peptide receptor type B; AMDM; NPRB; ANPRB; GUC2B; NPRBi;
Gene ID: 4882
mRNA Refseq: NM_003995
Protein Refseq: NP_003986
MIM: 108961
UniProt ID: P20594
Chromosome Location: 9p21-p12
Pathway: Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; Vascular smooth muscle contraction, organism-specific biosystem; Vascular smooth muscle contraction, conserved biosystem;
Function: ATP binding; GTP binding; guanylate cyclase activity; hormone binding; identical protein binding; natriuretic peptide receptor activity; nucleotide binding; peptide hormone binding; protein kinase activity; receptor activity; transferase activity, transferring phosphorus-containing groups; transmembrane signaling receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.