Recombinant Mouse Tslp protein, FC-tagged

Cat.No. : Tslp-469M
Product Overview : Recombinant Mouse Tslp(Gln67-Ser225) fused with FC tag at C-terminal was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : Fc
Protein Length : Gln67-Ser225
Form : Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4
AA Sequence : YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDK TFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPEVDDIEGRMD EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE PQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 21 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 19X PBS.Please aliquot the reconstituted solution.
Shipping : The product is shipped at ambient temperature.
Gene Name Tslp thymic stromal lymphopoietin [ Mus musculus ]
Official Symbol Tslp
Synonyms TSLP; thymic stromal lymphopoietin; thymic stroma-derived lymphopoietin;
Gene ID 53603
mRNA Refseq NM_021367
Protein Refseq NP_067342
MIM
UniProt ID Q9JIE6
Chromosome Location 18 B1; 18 18.12 Cm
Pathway Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem;
Function cytokine activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tslp Products

Required fields are marked with *

My Review for All Tslp Products

Required fields are marked with *

0
cart-icon