"Tslp" Related Products

Expand

Recombinant Mouse Tslp protein, FC-tagged

Cat.No.: Tslp-469M
Product Overview: Recombinant Mouse Tslp(Gln67-Ser225) fused with FC tag at C-terminal was expressed in HEK293.
Source: HEK293
Species: Mouse
Tag: FC
Form: Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4
Protein length: Gln67-Ser225
AA Sequence: YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDK TFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPEVDDIEGRMD EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE PQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 21 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 19X PBS.Please aliquot the reconstituted solution.
Shipping: The product is shipped at ambient temperature.
Gene Name: Tslp thymic stromal lymphopoietin [ Mus musculus ]
Official Symbol: Tslp
Synonyms: TSLP; thymic stromal lymphopoietin; thymic stroma-derived lymphopoietin;
Gene ID: 53603
mRNA Refseq: NM_021367
Protein Refseq: NP_067342
MIM:
UniProt ID: Q9JIE6
Chromosome Location: 18 B1; 18 18.12 Cm
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem;
Function: cytokine activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.