Recombinant Mouse Tslp protein, FC-tagged Tslp-469M

Recombinant Mouse Tslp protein, FC-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Mouse Tslp protein, FC-tagged

Recombinant Mouse Tslp protein, FC-tagged

Tslp Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : Tslp-469M
Product Overview : Recombinant Mouse Tslp(Gln67-Ser225) fused with FC tag at C-terminal was expressed in HEK293.
Source : HEK293
Species : Mouse
Tag : FC
Form : Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4
Protein length : Gln67-Ser225
AA Sequence : YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDK TFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPEVDDIEGRMD EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE PQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 21 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 19X PBS.Please aliquot the reconstituted solution.
Shipping : The product is shipped at ambient temperature.
Gene Name : Tslp thymic stromal lymphopoietin [ Mus musculus ]
Official Symbol : Tslp
Synonyms : TSLP; thymic stromal lymphopoietin; thymic stroma-derived lymphopoietin;
Gene ID : 53603
mRNA Refseq : NM_021367
Protein Refseq : NP_067342
UniProt ID : Q9JIE6
Chromosome Location : 18 B1; 18 18.12 Cm
Pathway : Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem;
Function : cytokine activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy