Recombinant Human TSLP protein, His-SUMO-tagged
| Cat.No. : | TSLP-3627H |
| Product Overview : | Recombinant Human TSLP protein(Q969D9)(29-159aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 29-159aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 30.9 kDa |
| AA Sequence : | YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | TSLP thymic stromal lymphopoietin [ Homo sapiens ] |
| Official Symbol | TSLP |
| Synonyms | TSLP; thymic stromal lymphopoietin; |
| Gene ID | 85480 |
| mRNA Refseq | NM_033035 |
| Protein Refseq | NP_149024 |
| MIM | 607003 |
| UniProt ID | Q969D9 |
| ◆ Recombinant Proteins | ||
| TSLP-6809H | Recombinant Human TSLP protein, His & T7-tagged | +Inquiry |
| TSLP-5742C | Recombinant Cynomolgus TSLP protein, His-tagged, Biotinylated, Primary Amine Labeling | +Inquiry |
| TSLP-256C | Recombinant Cynomolgus TSLP protein (Met1-Gln159), His-tagged | +Inquiry |
| TSLP-258H | Recombinant Human TSLP Protein | +Inquiry |
| TSLP-1391H | Recombinant Human TSLP protein, His-Avi-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TSLP-1742MCL | Recombinant Mouse TSLP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSLP Products
Required fields are marked with *
My Review for All TSLP Products
Required fields are marked with *



