Recombinant Human TSLP protein
Cat.No. : | TSLP-312H |
Product Overview : | Recombinant Human TSLP protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 132 |
Description : | Thymic stromal lymphopoietin (TSLP) is a hemopoietic protein belonging to the cytokine family and is known to play an important role in the maturation of T cell populations through activation of antigen presenting cells. It is mainly expressed in a number of tissues including heart, liver and prostate. TSLP signals through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. After binding STAT5 phosphorylation is induced resulting in the expression of downstream transcription factors. Like IL-7, TSLP induces phosphorylation of STAT3 and STAT5, but uses kinases other than the JAKs for activation. TSLP has the functions of enhancing the maturation of CD11c+ dendritic cells and inducing allergic inflammation by directly activating mast cells. It expression is linked to many disease states including asthma, inflammatory arthritis, atopic dermatitis, and eczema and other allergic states. But the factors inducing the activation of TSLP release are not clearly defined. Human TSLP shares approximately 43 % a.a. sequence identity with mouse TSLP. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human IL-7Rα and human TSLP R co-transfected murine BaF3 pro-B cells is less than 0.3 ng/ml, corresponding to a specific activity of > 3.3 × 10⁶ IU/mg. |
Molecular Mass : | Approximately 15.1 kDa, a single non-glycosylated polypeptide chain containing 132 amino acids. |
AA Sequence : | MYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ |
Endotoxin : | Less than 1 EU/μg of rHuTSLP as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | TSLP |
Official Symbol | TSLP |
Synonyms | TSLP; thymic stromal lymphopoietin; |
Gene ID | 85480 |
mRNA Refseq | NM_033035 |
Protein Refseq | NP_149024 |
MIM | 607003 |
UniProt ID | Q969D9 |
◆ Recombinant Proteins | ||
TSLP-1389H | Active Recombinant Human TSLP protein, His-tagged | +Inquiry |
TSLP-8307H | Recombinant Human TSLP | +Inquiry |
TSLP-391H | Recombinant Human TSLP (R127A, R130A) protein, His-Avi-tagged | +Inquiry |
TSLP-2189C | Active Recombinant Cynomolgus TSLP protein, His & Avi-tagged, Biotinylated | +Inquiry |
TSLP-139H | Active Recombinant Human TSLP Protein, His-tagged, R127A, R130A | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSLP-1742MCL | Recombinant Mouse TSLP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSLP Products
Required fields are marked with *
My Review for All TSLP Products
Required fields are marked with *
0
Inquiry Basket