"TNFRSF13C" Related Products

Expand
Expand
Expand

Recombinant Human TNFRSF13C, Fc Chimera

Cat. No.: TNFRSF13C-491H
Product Overview: Recombinant Human tumor necrosis factor receptor encoding the signal peptide of human GH receptor was fused to the extracellular domain of human tumor necrosis factor receptor (aa 2-73), which was in turn fused to the Fc region of human IgG1 (aa 93-330). The chimeric protein was expressed in modifiedhuman 293 cells.
Description: BAFF receptor (B cell activating factor receptor) is a 19 kD type III membrane protein that is a member of the TNF receptor superfamily. The primary responsibility for BAFF R is the mediating role of BAFF in B-cell survival and maturation. BAFF R is one of three different receptors (also includes TACI and BCMA) specific for BAFF and plays a predominant role in BAFF induced B-cell development and survival.
Source: Human 293 cells.
Amino Acid Sequence: SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK.
Molecular Mass: Tumor necrosis factor receptor Chimera migrates as two bands at 35 and 38-46 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation. This compares with unmodified tumor necrosis factor receptor that has a predicted molecular mass of 34 kDa.
pI: Due to post-translational modifications Symansis tumor necrosis factor receptor Chimera separates into a number of glycoforms with a pI between 5 and 9.5 on 2D PAGE. This compares with the unmodified BAFF R - Fc Chimera that has a predicted pI of 8.4.
% Carbohydrate: Purified BAFF R - Fc Chimera consists of approximately 0-25% carbohydrate by weight.
Glycosylation: BAFF R – Fc Chimera is N- and O-glycosylated.
Purity: >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue.
Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Activity: The ED50of BAFF R – Fc Chimera is typically 0.02-0.08 μg/ml as measured by its ability to neutralize BAFF-mediated proliferation of the RPMI 8226 cell line.
Gene Name: TNFRSF13C tumor necrosis factor receptor superfamily, member 13C [ Homo sapiens ]
Synonyms: TNFRSF13C; tumor necrosis factor receptor superfamily, member 13C; BAFFR; CD268; BAFF-R; MGC138235; OTTHUMP000000 28746; B cell-activating factor receptor; BLyS receptor 3; BAFF receptor
Gene ID: 115650
mRNA Refseq: NM_052945
Protein Refseq: NP_443177
UniProt ID: Q96RJ3
Chromosome Location: 22q13.1-q13.3
MIM: 606269
Pathway: Cytokine-cytokine receptor interaction; Primary immunodeficiency
Function: receptor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.