Species : |
Human |
Source : |
HEK293 |
Tag : |
Fc |
Protein Length : |
2-73 a.a. |
Description : |
BAFF receptor (B cell activating factor receptor) is a 19 kD type III membrane protein that is a member of the TNF receptor superfamily. The primary responsibility for BAFF R is the mediating role of BAFF in B-cell survival and maturation. BAFF R is one of three different receptors (also includes TACI and BCMA) specific for BAFF and plays a predominant role in BAFF induced B-cell development and survival. |
Amino Acid Sequence : |
SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK. |
Molecular Mass : |
Tumor necrosis factor receptor Chimera migrates as two bands at 35 and 38-46 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation. This compares with unmodified tumor necrosis factor receptor that has a predicted molecular mass of 34 kDa. |
pI : |
Due to post-translational modifications Symansis tumor necrosis factor receptor Chimera separates into a number of glycoforms with a pI between 5 and 9.5 on 2D PAGE. This compares with the unmodified BAFF R - Fc Chimera that has a predicted pI of 8.4. |
% Carbohydrate : |
Purified BAFF R - Fc Chimera consists of approximately 0-25% carbohydrate by weight. |
Glycosylation : |
BAFF R – Fc Chimera is N- and O-glycosylated. |
Purity : |
>95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue. |
Formulation : |
When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. |
Reconstitution : |
It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
Storage : |
Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended. |
Activity : |
The ED50of BAFF R – Fc Chimera is typically 0.02-0.08 μg/ml as measured by its ability to neutralize BAFF-mediated proliferation of the RPMI 8226 cell line. |