Active Recombinant Human TNFRSF13C, Fc Chimera
Cat.No. : | TNFRSF13C-491H |
Product Overview : | Recombinant Human tumor necrosis factor receptor encoding the signal peptide of human GH receptor was fused to the extracellular domain of human tumor necrosis factor receptor (aa 2-73), which was in turn fused to the Fc region of human IgG1 (aa 93-330). The chimeric protein was expressed in modifiedhuman 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 2-73 a.a. |
Description : | BAFF receptor (B cell activating factor receptor) is a 19 kD type III membrane protein that is a member of the TNF receptor superfamily. The primary responsibility for BAFF R is the mediating role of BAFF in B-cell survival and maturation. BAFF R is one of three different receptors (also includes TACI and BCMA) specific for BAFF and plays a predominant role in BAFF induced B-cell development and survival. |
Amino Acid Sequence : | SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK. |
Molecular Mass : | Tumor necrosis factor receptor Chimera migrates as two bands at 35 and 38-46 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation. This compares with unmodified tumor necrosis factor receptor that has a predicted molecular mass of 34 kDa. |
pI : | Due to post-translational modifications Symansis tumor necrosis factor receptor Chimera separates into a number of glycoforms with a pI between 5 and 9.5 on 2D PAGE. This compares with the unmodified BAFF R - Fc Chimera that has a predicted pI of 8.4. |
% Carbohydrate : | Purified BAFF R - Fc Chimera consists of approximately 0-25% carbohydrate by weight. |
Glycosylation : | BAFF R – Fc Chimera is N- and O-glycosylated. |
Purity : | >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue. |
Formulation : | When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. |
Reconstitution : | It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
Storage : | Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended. |
Activity : | The ED50of BAFF R – Fc Chimera is typically 0.02-0.08 μg/ml as measured by its ability to neutralize BAFF-mediated proliferation of the RPMI 8226 cell line. |
Gene Name | TNFRSF13C tumor necrosis factor receptor superfamily, member 13C [ Homo sapiens ] |
Synonyms | TNFRSF13C; tumor necrosis factor receptor superfamily, member 13C; BAFFR; CD268; BAFF-R; MGC138235; OTTHUMP000000 28746; B cell-activating factor receptor; BLyS receptor 3; BAFF receptor |
Gene ID | 115650 |
mRNA Refseq | NM_052945 |
Protein Refseq | NP_443177 |
UniProt ID | Q96RJ3 |
Chromosome Location | 22q13.1-q13.3 |
MIM | 606269 |
Pathway | Cytokine-cytokine receptor interaction; Primary immunodeficiency |
Function | receptor activity |
◆ Recombinant Proteins | ||
TNFRSF13C-5255H | Recombinant Human Tumor Necrosis Factor Receptor Superfamily, Member 13C | +Inquiry |
TNFRSF13C-3992H | Recombinant Human TNFRSF13C Protein (Arg2-Ala71), C-Fc tagged | +Inquiry |
Tnfrsf13c-218R | Recombinant Rat Tnfrsf13c protein, His/S-tagged | +Inquiry |
TNFRSF13C-2187R | Active Recombinant Rat TNFRSF13C protein, His-tagged | +Inquiry |
TNFRSF13C-362H | Recombinant Human TNFRSF13C Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF13C-1861MCL | Recombinant Mouse TNFRSF13C cell lysate | +Inquiry |
TNFRSF13C-831RCL | Recombinant Rat TNFRSF13C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF13C Products
Required fields are marked with *
My Review for All TNFRSF13C Products
Required fields are marked with *
0
Inquiry Basket