"IFNGR1" Related Products

Expand

Recombinant Human Interferon Gamma Receptor 1, Fc Chimera

Cat. No.: IFNGR1-22H
Product Overview: Recombinant Human Interferon Gamma Receptor 1 encoding the signal peptide and extracellular domain of human IFN-gamma R1 (aa 1-245) chain was fused to the Fc region of human IgG1 (aa 93-330). The chimeric protein was expressed in modifiedhuman 293 cells.
Description: Interferon-gamma (IFN-gamma) is a pleotropic cytokine expressed predominantly by naïve and activated CD8+ and TH1 CD4+ T cells, and natural killer (NK) cells and, as such, promotes both innate and adaptive immune responses.The activity of IFN-gamma is mediated through its receptor, the high-affinity IFN-gamma receptor complex, a class II cytokine receptor that is present on T cells, B cells, macrophages, neutrophils and NK cells as well as non-immune somatic cells such as endothelial cells and fibroblasts.
Source: Human 293 cells.
Amino Acid Sequence: EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK.
Molecular Mass: IFN-gamma R1 – Fc Chimera migrates as a broad band between 60 and 85 kDa on SDS-PAGE due to post-translation modifications, in particular glycosylation.
pI: IFN-gamma R1 – Fc Chimera separates into a number of glycoforms with a pI between 5 and 8 in 2D PAGE due to post-translational modifications, in particular glycosylation.
% Carbohydrate: Purified IFN-gamma R1 – Fc Chimera consists of 10-35% carbohydrate by weight.
Glycosylation: IFN-gamma R1 – Fc Chimera has N- and possibly O-linked oligosaccharides.
Purity: >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue.
Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Activity: The ED50 of IFN-gamma R1 – Fc Chimera is typically 0.05-0.1 μg/ml as measured by its ability to neutralize IFN gamma mediated cytotoxicity using the HT-29 colorectal adenocarcinoma cell line.
Gene Name: IFNGR1 interferon gamma receptor 1 [ Homo sapiens ]
Synonyms: IFNGR1; interferon gamma receptor 1; CD119; IFNGR; FLJ45734; AVP, type 2; CD119 antigen; immune interferon receptor 1; interferon-gamma receptor alpha chain; IFN-gamma-R1; OTTHUMP00000017285; interferon gamma receptor 1
Gene ID: 3459
mRNA Refseq: NM_000416
Protein Refseq: NP_000407
UniProt ID: P15260
Chromosome Location: 6q23-q24
MIM: 107470
Pathway: Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway; Natural killer cell mediated cytotoxicity
Function: cytokine binding; interferon-gamma receptor activity; receptor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.