"IFNGR1" Related Products

Expand
Expand

Recombinant Human Interferon Gamma Receptor 1, Fc Chimera

Cat. No.: IFNGR1-22H
Product Overview: Recombinant Human Interferon Gamma Receptor 1 encoding the signal peptide and extracellular domain of human IFN-gamma R1 (aa 1-245) chain was fused to the Fc region of human IgG1 (aa 93-330). The chimeric protein was expressed in modifiedhuman 293 cells.
Description: Interferon-gamma (IFN-gamma) is a pleotropic cytokine expressed predominantly by naïve and activated CD8+ and TH1 CD4+ T cells, and natural killer (NK) cells and, as such, promotes both innate and adaptive immune responses.The activity of IFN-gamma is mediated through its receptor, the high-affinity IFN-gamma receptor complex, a class II cytokine receptor that is present on T cells, B cells, macrophages, neutrophils and NK cells as well as non-immune somatic cells such as endothelial cells and fibroblasts.
Source: Human 293 cells.
Amino Acid Sequence: EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK.
Molecular Mass: IFN-gamma R1 – Fc Chimera migrates as a broad band between 60 and 85 kDa on SDS-PAGE due to post-translation modifications, in particular glycosylation.
pI: IFN-gamma R1 – Fc Chimera separates into a number of glycoforms with a pI between 5 and 8 in 2D PAGE due to post-translational modifications, in particular glycosylation.
% Carbohydrate: Purified IFN-gamma R1 – Fc Chimera consists of 10-35% carbohydrate by weight.
Glycosylation: IFN-gamma R1 – Fc Chimera has N- and possibly O-linked oligosaccharides.
Purity: >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue.
Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Activity: The ED50 of IFN-gamma R1 – Fc Chimera is typically 0.05-0.1 μg/ml as measured by its ability to neutralize IFN gamma mediated cytotoxicity using the HT-29 colorectal adenocarcinoma cell line.
Gene Name: IFNGR1 interferon gamma receptor 1 [ Homo sapiens ]
Synonyms: IFNGR1; interferon gamma receptor 1; CD119; IFNGR; FLJ45734; AVP, type 2; CD119 antigen; immune interferon receptor 1; interferon-gamma receptor alpha chain; IFN-gamma-R1; OTTHUMP00000017285; interferon gamma receptor 1
Gene ID: 3459
mRNA Refseq: NM_000416
Protein Refseq: NP_000407
UniProt ID: P15260
Chromosome Location: 6q23-q24
MIM: 107470
Pathway: Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway; Natural killer cell mediated cytotoxicity
Function: cytokine binding; interferon-gamma receptor activity; receptor activity

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.