Active Recombinant Human Thrombopoietin

Cat.No. : THPO-82H
Product Overview : Recombinant Human Thrombopoietin (TPO) was expressed in modifiedhuman 293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Non
Protein Length : 22-353 aa
Description : Thrombopoietin (TPO), a hormone predominately expressed in liver and bone marrow stromal cells, is the principal regulator of proliferation and differentiation of megakaryoctytes, and is the major cytokine involved in platelet production. TPO has also been shown to pay a role in production of primitive pluripotent stem cells and progenitor cells, such as erythroid and myeloid progenitor cells. Human TPO cDNA encodes a 353 amino acid precursor protein that is cleaved upon secretion from the cell. Mature human TPO is a 95kDa glycoprotein that comprises two domains, a receptor binding domain that shares homology with erythropoietin, and a heavily O- and N-linked glycosylated region at the carboxy terminus.
Theoretical Sequence : SPAPPACDLRVLSK LLRDSHVLHSRLSQC PEVHPLPTPVLLPAVDF SLGEW KTQ MEE TKAQDILGAVTLLLEG VMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLG TQLPPQGRTTAHKDPNAIFLSFQHLL RGKVRFLMLVGGSTLCVRRAPPTTAVPSRT SLVLTLN ELPNRTSGLLE NFTASARTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIP G YLNRIHELN GTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPP TG QYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG.
Molecular Mass : Thrombopoietin migrates as a broad band between 75 and 100 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with unmodified Thrombopoietin that has a predicted molecular mass of 35.5 kDa.
PI : Thrombopoietin separates into a number of isoforms with a pI less than 5.0 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified Thrombopoietin that has a predicted pI of 9.69.
% Carbohydrate : Thrombopoietin consists of greater than 35% carbohydrate by weight.
Glycosylation : Thrombopoietin contains N- and O-linked oligosaccharides.
Purity : >95%, as determined by SDS-PAGE and visualized by silver stain.
Formulation : When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution : It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage : Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C.
Activity : The ED50of TPO is typically 2.5 to 10 ng/ml as measured in a cell proliferation assay using the human growth factor dependent TF-1 cell line.
Gene Name THPO thrombopoietin [ Homo sapiens ]
Synonyms thrombopoietin nirs variant 1; megakaryocyte stimulating factor; MKCSF; c-mpl ligand; megakaryocyte colony-stimulating factor; MGDF; megakaryocyte growth and development factor; MPL ligand; myeloproliferative leukemia virus oncogene ligand; C-mpl ligand; Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor; MGC163194; Myeloproliferative leukemia virus oncogene ligand; Thrombopoietin; ML; TPO; MPLLG; THPO
Gene ID 7066
mRNA Refseq NM_000460
Protein Refseq NP_000451
MIM 600044
UniProt ID P40225
Chromosome Location 3q27
Pathway Hematopoietic cell lineage
Function cytokine activity; growth factor activity; hormone activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All THPO Products

Required fields are marked with *

My Review for All THPO Products

Required fields are marked with *

0
cart-icon