Recombinant Mouse Il11 protein

Cat.No. : Il11-161M
Product Overview : Recombinant Mouse Il11 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 179
Description : Interleukin-11 (IL-11) is encoded by the II11 gene. IL-11 is a multifunctional cytokine first isolated from bone marrow-derived stromal cells. IL-11 receptor activation requires formation of a complex of two IL-11 molecules with two molecules of the ligand-binding IL-11 Rα subunit and two molecules of the expressed cell signaling β subunit, gp130. IL-11 is a member of the IL-6 superfamily, distinguished based on their use of the common co-receptor gp130. IL-11 can directly stimulate the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, and induce megakaryocyte maturation resulting in increased platelet production. Mature murine IL-11 shares 88 % amino acid sequence identity with human IL-11.
Form : Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine T11 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg.
Molecular Mass : Approximately 19.1 kDa, a single non-glycosylated polypeptide chain containing 179 amino acids.
AA Sequence : MPGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Endotoxin : Less than 1 EU/µg of rMuIL-11 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Il11
Official Symbol Il11
Synonyms IL11; interleukin 11; interleukin-11; IL-11;
Gene ID 16156
mRNA Refseq NM_008350
Protein Refseq NP_032376
UniProt ID P47873

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il11 Products

Required fields are marked with *

My Review for All Il11 Products

Required fields are marked with *

0
cart-icon