Species : |
Mouse |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
179 |
Description : |
Interleukin-11 (IL-11) is encoded by the II11 gene. IL-11 is a multifunctional cytokine first isolated from bone marrow-derived stromal cells. IL-11 receptor activation requires formation of a complex of two IL-11 molecules with two molecules of the ligand-binding IL-11 Rα subunit and two molecules of the expressed cell signaling β subunit, gp130. IL-11 is a member of the IL-6 superfamily, distinguished based on their use of the common co-receptor gp130. IL-11 can directly stimulate the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, and induce megakaryocyte maturation resulting in increased platelet production. Mature murine IL-11 shares 88 % amino acid sequence identity with human IL-11. |
Form : |
Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4. |
Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine T11 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg. |
Molecular Mass : |
Approximately 19.1 kDa, a single non-glycosylated polypeptide chain containing 179 amino acids. |
AA Sequence : |
MPGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
Endotoxin : |
Less than 1 EU/µg of rMuIL-11 as determined by LAL method. |
Purity : |
>97% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |