Active Recombinant Mouse Il11 Protein
Cat.No. : | Il11-182I |
Product Overview : | Recombinant Mouse Il11 Protein without tag was expressed in HEK 293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Description : | Interleukin-11 (IL-11) is a pleiotropic cytokine that was originally detected in the conditioned medium of an IL-1α-stimulated primate bone marrow stromal cell line (PU-34) as a mitogen for the IL-6-responsive mouse plasmacytoma cell line T11. IL-11 contains no cysteine residues or potential glycosylation sites. IL-11 has multiple effects on both hematopoietic and nonhematopoietic cells. Many of the biological effects described for IL-11 overlap those for IL-6. In vitro, IL-11 can synergize with IL-3, IL-4 and SCF to shorten the G0 period of early hematopoietic progenitors. IL-11 also enhances the IL-3-dependent megakaryocyte colony formation. IL-11 has been found to stimulate the T cell dependent development of specific immunoglobulin-secreting B cell. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 3 ng/mL, measured in a cell proliferation assay using T11 cells. |
Molecular Mass : | ~21 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | GPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant Murine Interleukin-11 (IL-11) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Murine Interleukin-11 (IL-11) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Il11 interleukin 11 [ Mus musculus ] |
Official Symbol | Il11 |
Synonyms | IL11; interleukin 11; interleukin-11; IL-11; |
Gene ID | 16156 |
mRNA Refseq | NM_008350 |
Protein Refseq | NP_032376 |
UniProt ID | P47873 |
◆ Recombinant Proteins | ||
IL11-551H | Recombinant Human Interleukin 11 | +Inquiry |
IL11-259I | Active Recombinant Human IL11 Protein | +Inquiry |
IL11-842H | Recombinant Human IL11 protein, His & T7-tagged | +Inquiry |
IL11-123H | Recombinant Human IL11 protein | +Inquiry |
IL11-416H | Active Recombinant Human Interleukin-11 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL11-5249HCL | Recombinant Human IL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il11 Products
Required fields are marked with *
My Review for All Il11 Products
Required fields are marked with *
0
Inquiry Basket