Active Recombinant Mouse Il11 Protein

Cat.No. : Il11-182I
Product Overview : Recombinant Mouse Il11 Protein without tag was expressed in HEK 293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Description : Interleukin-11 (IL-11) is a pleiotropic cytokine that was originally detected in the conditioned medium of an IL-1α-stimulated primate bone marrow stromal cell line (PU-34) as a mitogen for the IL-6-responsive mouse plasmacytoma cell line T11. IL-11 contains no cysteine residues or potential glycosylation sites. IL-11 has multiple effects on both hematopoietic and nonhematopoietic cells. Many of the biological effects described for IL-11 overlap those for IL-6. In vitro, IL-11 can synergize with IL-3, IL-4 and SCF to shorten the G0 period of early hematopoietic progenitors. IL-11 also enhances the IL-3-dependent megakaryocyte colony formation. IL-11 has been found to stimulate the T cell dependent development of specific immunoglobulin-secreting B cell.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 3 ng/mL, measured in a cell proliferation assay using T11 cells.
Molecular Mass : ~21 kDa, observed by reducing SDS-PAGE.
AA Sequence : GPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant Murine Interleukin-11 (IL-11) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Murine Interleukin-11 (IL-11) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Il11 interleukin 11 [ Mus musculus ]
Official Symbol Il11
Synonyms IL11; interleukin 11; interleukin-11; IL-11;
Gene ID 16156
mRNA Refseq NM_008350
Protein Refseq NP_032376
UniProt ID P47873

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il11 Products

Required fields are marked with *

My Review for All Il11 Products

Required fields are marked with *

0
cart-icon
0
compare icon