"FGF19" Related Products

Expand
Expand
Expand

Recombinant Human FGF19 protein

Cat.No. : FGF19-238H
Product Overview : Recombinant Human FGF19 protein was expressed in Escherichia coli.
Description : Human FGF-19 is encoded by the FGF19 gene. FGF-19 belongs to the FGF-19 subfamily which has three members FGF-19, 21, 23. FGFs are classically considered to be paracrine factors and are known for their roles in tissue patterning and organogenesis during embryogenesis. By contrast, the FGF-19 subfamily has recently been shown to function in an endocrine manner. Members of this subfamily have poor ability of binding to heparin binding site which is a crucial factor in ligand-receptor complex formation. β-Klotho has been identified as co-factor required for FGF-19, 21, 23 signaling. It can obviously increase ligand-receptor affinity. Unlike most FGFs which bind to and activate more than one FGF receptor, FGF19 is a specific ligand for FGF R4. In FGF-19 transgenic mice, reducing liver triglycerides, increasing fatty acid oxidation, reducing glucose levels and improving insulin sensitivity can be observed.
Source : E.coli
Species : Human
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Assay #1: Fully biologically active when compared to standard. The biological activity is measured by its binding ability in a functional ELISA. Immobilized rHuFGF R4 at 5 µg/ml can bind rHuFGF-19 with a linear range of 3-200 ng/ml.Assay #2: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 150 ng/ml, corresponding to a specific activity of > 6.7 × 103 IU/mg.
Molecular Mass : Approximately 21.8 kDa, a single non-glycosylated polypeptide chain containing 195 amino acids.
Protein length : 195
AA Sequence : MRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Endotoxin : Less than 1 EU/µg of rHuFGF-19 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : FGF19
Official Symbol : FGF19
Synonyms : FGF19; fibroblast growth factor 19; FGF-19;
Gene ID : 9965
mRNA Refseq : NM_005117
Protein Refseq : NP_005108
MIM : 603891
UniProt ID : O95750

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.