Recombinant Human NF1 Protein, His-tagged

Cat.No. : NF1-334H
Product Overview : Recombinant Human NF1 protein with His tag was expressed in E.coli.
Availability September 17, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene product appears to function as a negative regulator of the ras signal transduction pathway. Mutations in this gene have been linked to neurofibromatosis type 1, juvenile myelomonocytic leukemia and Watson syndrome. The mRNA for this gene is subject to RNA editing (CGA>UGA->Arg1306Term) resulting in premature translation termination. Alternatively spliced transcript variants encoding different isoforms have also been described for this gene.
Molecular Mass : ~40.2 kDa, reducing conditions
AA Sequence : MGSSHHHHHHSSGLVPRGSHMETVLADRFERLVELVTMMGDQGELPIAMALANVVPCSQWDELARVLVTLFDSRHLLYQLLWNMFSKEVELADSMQTLFRGNSLASKIMTFCFKVYGATYLQKLLDPLLRIVITSSDWQHVSFEVDPTRLEPSESLEENQRNLLQMTEKFFHAIISSSSEFPPQLRSVCHCLYQVVSQRFPQNSIGAVGSAMFLRFINPAIVSPYEAGILDKKPPPRIERGLKLMSKILQSIANHVLFTKEEHMRPFNDFVKSNFDAARRFFLDIASDCPTSDAVNHSLSFISDGNVLALHRLLWNNQEKIGQYLSSNRDHKAVGRRPFDKMATLLAYLGPPEH
Purity : >90%, by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.16 mg/mL
Storage Buffer : Supplied as a 0.2 μm filtered solution in 50 mM Tris-HCl, pH 7.5, 200 mM NaCl.
Publications :
An essential role for Argonaute 2 in EGFR-KRAS signaling in pancreatic cancer development (2020)
Gene Name NF1 neurofibromin 1 [ Homo sapiens (human) ]
Official Symbol NF1
Synonyms NF1; neurofibromin 1; WSS; NFNS; VRNF; neurofibromin; neurofibromatosis 1; neurofibromatosis-related protein NF-1; truncated neurofibromin 1
Gene ID 4763
mRNA Refseq NM_000267
Protein Refseq NP_000258
MIM 613113
UniProt ID P21359

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NF1 Products

Required fields are marked with *

My Review for All NF1 Products

Required fields are marked with *

0
cart-icon
0
compare icon