Recombinant Human Endothelial Cell-specific Molecule 1, His-tagged ESM1-902H

Recombinant Human Endothelial Cell-specific Molecule 1, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human Endothelial Cell-specific Molecule 1, His-tagged

Recombinant Human Endothelial Cell-specific Molecule 1, His-tagged

ESM1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat. No. : ESM1-902H
Product Overview : Recombinant Human ESM1 encoding the human mature ESM1 (Trp20-Arg184) with 6 His tag on the N-Terminus was expressed inE. Coli. This protein was purified by Ni-NTA column.MW=20KDa.
Description : Endothelial cell-specific molecule 1 is a protein that in humans is encoded by the ESM1 gene. This gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of this gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disorders. The transcript contains multiple polyadenylation and mRNA instability signals.
Source : E. Coli.
Sequence : Human mature ESM1 (Trp20-Arg184)20WSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR184.
Purity : >95% in SDS gel.
Formulation : Lyophilized 100 μg humanmature ESM1 in 50 μl of TBS (20 mM Tris, 50mM NaCl, pH8.0). Carry free.
Application : Cell biology, ELISA.
Reconstitution : Add 500 μl deionized water to the vial to prepare a working stock solution at 200 μg/mL. Allow to set at least 30 minutes at 4°C, mix well.
Storage : Store lyophilized protein at -20°C or -70°C. Lyophilized protein is stable for up to 6 months from date of receipt at -70°C. Upon reconstitution, this protein can be stored at for a few weeks or at -70°C in a manual defrost freezer for long term storage (six months). Aliquot reconstituted protein to avoid repeated freezing / thawing cycles.
Gene Name : ESM1 endothelial cell-specific molecule 1 [ Homo sapiens ]
Synonyms : ESM1; endothelial cell-specific molecule 1; endocan;ESM-1 secretory protein; ESM-1
Gene ID : 11082
mRNA Refseq : NM_001135604
Protein Refseq : NP_001129076
MIM : 601521
UniProt ID : Q9NQ30
Chromosome Location : 5q11
Function : growth factor activity; insulin-like growth factor binding; protein binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy