"ESM1" Related Products

Expand
Expand
Expand

Recombinant Human Endothelial Cell-specific Molecule 1, His-tagged

Cat. No.: ESM1-902H
Product Overview: Recombinant Human ESM1 encoding the human mature ESM1 (Trp20-Arg184) with 6 His tag on the N-Terminus was expressed inE. Coli. This protein was purified by Ni-NTA column.MW=20KDa.
Description: Endothelial cell-specific molecule 1 is a protein that in humans is encoded by the ESM1 gene. This gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of this gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disorders. The transcript contains multiple polyadenylation and mRNA instability signals.
Source: E. Coli.
Sequence: Human mature ESM1 (Trp20-Arg184)20WSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR184.
Purity: >95% in SDS gel.
Formulation: Lyophilized 100 μg humanmature ESM1 in 50 μl of TBS (20 mM Tris, 50mM NaCl, pH8.0). Carry free.
Application: Cell biology, ELISA.
Reconstitution: Add 500 μl deionized water to the vial to prepare a working stock solution at 200 μg/mL. Allow to set at least 30 minutes at 4°C, mix well.
Storage: Store lyophilized protein at -20°C or -70°C. Lyophilized protein is stable for up to 6 months from date of receipt at -70°C. Upon reconstitution, this protein can be stored at for a few weeks or at -70°C in a manual defrost freezer for long term storage (six months). Aliquot reconstituted protein to avoid repeated freezing / thawing cycles.
Gene Name: ESM1 endothelial cell-specific molecule 1 [ Homo sapiens ]
Synonyms: ESM1; endothelial cell-specific molecule 1; endocan;ESM-1 secretory protein; ESM-1
Gene ID: 11082
mRNA Refseq: NM_001135604
Protein Refseq: NP_001129076
MIM: 601521
UniProt ID: Q9NQ30
Chromosome Location: 5q11
Function: growth factor activity; insulin-like growth factor binding; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.