| Species : |
Rat |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
72 |
| Description : |
CXCL12 also known as SDF-1 is belonging to the CXC chemokine family. Rat CXCL12 is expressed as two isoforms that differ only in the C-terminal tail. And both SDF-1 isoforms undergo proteolytic processing of the first two N-terminal amino acids. In all SDF-1 isoforms, SDF-1β is the canonical sequence. It has the complete amino acids in the C-terminal tail. On the cell surface, the receptor for this chemokine is CXCR4 and syndecan4. CXCL12 is strongly chemotactic for T-lymphocytes, monocytes, but not neutrophils. SDF-1 is highly conserved between species, murine CXCL12β shares approximately 96 % amino acid sequence identity with human CXCL12β. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl. |
| Bio-activity : |
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 100-200 ng/ml. |
| Molecular Mass : |
Approximately 8.4 kDa, a single non-glycosylated polypeptide chain containing 72 amino acids. |
| AA Sequence : |
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKSNNRQVCIDPKLKWIQEYLDKALNKRLKM |
| Endotoxin : |
Less than 1 EU/μg of rRtSDF-1β/CXCL12β as determined by LAL method. |
| Purity : |
>97% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
