Recombinant Canine CXCL12 Protein

Cat.No. : CXCL12-3920C
Product Overview : Recombinant Canine CXCL12 was produced in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Canine
Source : E.coli
Tag : Non
Form : 20 mM Tris-HCl, 0.10 M NaCl, pH 8.0
Molecular Mass : ~25 kDa
AA sequence : MNHHHHHHGGSGGSGSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQAPEDLDMEDNDIIEAHREQIGGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNSRQVCIDPKLKWIQEYLEKALNK
Endotoxin : < 1.0 EU per μg of the protein as determined by the LAL method
Purity : >90%, by SDS-PAGE
Gene Name CXCL12 chemokine (C-X-C motif) ligand 12 [ Canis lupus familiaris(dog) ]
Official Symbol CXCL12
Synonyms CXCL12; chemokine (C-X-C motif) ligand 12; SDF1; stromal cell-derived factor 1; chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1)
Gene ID 449622
mRNA Refseq NM_001128097
Protein Refseq NP_001121569

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL12 Products

Required fields are marked with *

My Review for All CXCL12 Products

Required fields are marked with *

0
cart-icon
0
compare icon