Recombinant Canine CXCL12 Protein
| Cat.No. : | CXCL12-3920C |
| Product Overview : | Recombinant Canine CXCL12 was produced in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Canine |
| Source : | E.coli |
| Tag : | Non |
| Form : | 20 mM Tris-HCl, 0.10 M NaCl, pH 8.0 |
| Molecular Mass : | ~25 kDa |
| AA sequence : | MNHHHHHHGGSGGSGSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQAPEDLDMEDNDIIEAHREQIGGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNSRQVCIDPKLKWIQEYLEKALNK |
| Endotoxin : | < 1.0 EU per μg of the protein as determined by the LAL method |
| Purity : | >90%, by SDS-PAGE |
| Gene Name | CXCL12 chemokine (C-X-C motif) ligand 12 [ Canis lupus familiaris(dog) ] |
| Official Symbol | CXCL12 |
| Synonyms | CXCL12; chemokine (C-X-C motif) ligand 12; SDF1; stromal cell-derived factor 1; chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) |
| Gene ID | 449622 |
| mRNA Refseq | NM_001128097 |
| Protein Refseq | NP_001121569 |
| ◆ Recombinant Proteins | ||
| Cxcl12-11719M | Recombinant mouse Cxcl12, GST-tagged | +Inquiry |
| CXCL12-2167H | Active Recombinant Human CXCL12 protein, His-tagged | +Inquiry |
| CXCL12-54H | Recombinant Active Human CXCL12 Protein, His-tagged(C-ter) | +Inquiry |
| CXCL12-23H | Recombinant Human CXCL12 Protein, Biotin-tagged | +Inquiry |
| CXCL12-133H | Active Recombinant Human CXCL12, biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL12-1863CCL | Recombinant Cynomolgus CXCL12 cell lysate | +Inquiry |
| CXCL12-3016HCL | Recombinant Human CXCL12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL12 Products
Required fields are marked with *
My Review for All CXCL12 Products
Required fields are marked with *
