Recombinant Canine CXCL12 Protein
Cat.No. : | CXCL12-3920C |
Product Overview : | Recombinant Canine CXCL12 was produced in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Canine |
Source : | E.coli |
Tag : | Non |
Form : | 20 mM Tris-HCl, 0.10 M NaCl, pH 8.0 |
Molecular Mass : | ~25 kDa |
AA sequence : | MNHHHHHHGGSGGSGSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQAPEDLDMEDNDIIEAHREQIGGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNSRQVCIDPKLKWIQEYLEKALNK |
Endotoxin : | < 1.0 EU per μg of the protein as determined by the LAL method |
Purity : | >90%, by SDS-PAGE |
Gene Name | CXCL12 chemokine (C-X-C motif) ligand 12 [ Canis lupus familiaris(dog) ] |
Official Symbol | CXCL12 |
Synonyms | CXCL12; chemokine (C-X-C motif) ligand 12; SDF1; stromal cell-derived factor 1; chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) |
Gene ID | 449622 |
mRNA Refseq | NM_001128097 |
Protein Refseq | NP_001121569 |
◆ Recombinant Proteins | ||
CXCL12-031H | Recombinant Human CXCL12 Protein | +Inquiry |
CXCL12-629H | Recombinant Human CXCL12 protein(Lys22-Lys89) | +Inquiry |
Cxcl12-208C | Active Recombinant Mouse Cxcl12 Protein (68 aa) | +Inquiry |
CXCL12-383C | Recombinant Canine CXCL12 protein(Lys22-Met93) | +Inquiry |
CXCL12-5382H | Recombinant Human CXCL12 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL12-1863CCL | Recombinant Cynomolgus CXCL12 cell lysate | +Inquiry |
CXCL12-3016HCL | Recombinant Human CXCL12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL12 Products
Required fields are marked with *
My Review for All CXCL12 Products
Required fields are marked with *