"CXCL12" Related Products

Expand
Expand

Recombinant Canine CXCL12 Protein

Cat.No.: CXCL12-3920C
Product Overview: Recombinant Canine CXCL12 was produced in E. coli.
Source: E. coli
Species: Canine
Form: 20 mM Tris-HCl, 0.10 M NaCl, pH 8.0
Molecular Mass: ~25 kDa
AA sequence: MNHHHHHHGGSGGSGSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQAPEDLDMEDNDIIEAHREQIGGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNSRQVCIDPKLKWIQEYLEKALNK
Endotoxin: < 1.0 EU per μg of the protein as determined by the LAL method
Purity: >90%, by SDS-PAGE
Gene Name: CXCL12 chemokine (C-X-C motif) ligand 12 [ Canis lupus familiaris(dog) ]
Official Symbol: CXCL12
Synonyms: CXCL12; chemokine (C-X-C motif) ligand 12; SDF1; stromal cell-derived factor 1; chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1)
Gene ID: 449622
mRNA Refseq: NM_001128097
Protein Refseq: NP_001121569

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.