Recombinant Human CXCL12 Protein, Biotinylated

Cat.No. : CXCL12-033H
Product Overview : Biotinylated Recombinant human CXCL12 protein was tag free expressed.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Protein Length : 93
Description : This antimicrobial gene encodes a stromal cell-derived alpha chemokine member of the intercrine family. The encoded protein functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene.
Form : Lyophilized
AA Sequence : MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Purity : > 97%
Applications : WB
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Storage Buffer : PBS (pH 7.4-7.5)
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Conjugation : Biotin
Gene Name CXCL12 C-X-C motif chemokine ligand 12 [ Homo sapiens (human) ]
Official Symbol CXCL12
Synonyms CXCL12; C-X-C motif chemokine ligand 12; IRH; PBSF; SDF1; TLSF; TPAR1; SCYB12; stromal cell-derived factor 1; chemokine (C-X-C motif) ligand 12; intercrine reduced in hepatomas; pre-B cell growth-stimulating factor
Gene ID 6387
mRNA Refseq NM_000609
Protein Refseq NP_000600
MIM 600835
UniProt ID P48061

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL12 Products

Required fields are marked with *

My Review for All CXCL12 Products

Required fields are marked with *

0
cart-icon