Recombinant Human CXCL12 Protein, Biotinylated
Cat.No. : | CXCL12-033H |
Product Overview : | Biotinylated Recombinant human CXCL12 protein was tag free expressed. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Protein Length : | 93 |
Description : | This antimicrobial gene encodes a stromal cell-derived alpha chemokine member of the intercrine family. The encoded protein functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | Lyophilized |
AA Sequence : | MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
Purity : | > 97% |
Applications : | WB |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Storage Buffer : | PBS (pH 7.4-7.5) |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CXCL12 C-X-C motif chemokine ligand 12 [ Homo sapiens (human) ] |
Official Symbol | CXCL12 |
Synonyms | CXCL12; C-X-C motif chemokine ligand 12; IRH; PBSF; SDF1; TLSF; TPAR1; SCYB12; stromal cell-derived factor 1; chemokine (C-X-C motif) ligand 12; intercrine reduced in hepatomas; pre-B cell growth-stimulating factor |
Gene ID | 6387 |
mRNA Refseq | NM_000609 |
Protein Refseq | NP_000600 |
MIM | 600835 |
UniProt ID | P48061 |
◆ Recombinant Proteins | ||
CXCL12-031H | Recombinant Human CXCL12 Protein | +Inquiry |
CXCL12-2202H | Recombinant Human CXCL12 Protein (Ser19-Met93) | +Inquiry |
CXCL12-1107R | Recombinant Rhesus monkey CXCL12 Protein, His-tagged | +Inquiry |
Cxcl12-11719M | Recombinant mouse Cxcl12, GST-tagged | +Inquiry |
CXCL12-191H | Recombinant Human CXCL12 Protein, DYKDDDDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL12-1863CCL | Recombinant Cynomolgus CXCL12 cell lysate | +Inquiry |
CXCL12-3016HCL | Recombinant Human CXCL12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL12 Products
Required fields are marked with *
My Review for All CXCL12 Products
Required fields are marked with *