"A2LD1" Related Products

Recombinant Human A2LD1, His-tagged

Cat.No.: A2LD1-26036TH
Product Overview: Recombinant full length Human A2LD1 with an N terminal His tag; 173 amino acids with a predicted MWt 19.4kDa including tag.
Description: The protein encoded by this gene aids in the proteolytic degradation of crosslinked fibrin by breaking down isodipeptide L-gamma-glutamyl-L-epsilon-lysine, a byproduct of fibrin degradation. The reaction catalyzed by the encoded gamma-glutamylaminecyclotransferase produces 5-oxo-L-proline and a free alkylamine. Two transcript variants encoding the same protein have been found for this gene.
Protein length: 153 amino acids
Conjugation: HIS
Molecular Weight: 19.400kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEEPPAPTAVQCFVYSRATFPPEWAQLPHHDSYDSEGPHGLRYNPRENR
Sequence Similarities: Belongs to the gamma-glutamylcyclotransferase family.
Gene Name: A2LD1 AIG2-like domain 1 [ Homo sapiens ]
Official Symbol: A2LD1
Synonyms: A2LD1; AIG2-like domain 1; gamma-glutamylaminecyclotransferase; gamma glutamylamine cyclotransferase; GGACT;
Gene ID: 87769
mRNA Refseq: NM_033110
Protein Refseq: NP_149101
MIM: 613378
Uniprot ID: Q9BVM4
Chromosome Location: 13q32.3
Function: gamma-glutamylcyclotransferase activity; transferase activity, transferring acyl groups;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.