Recombinant Human A2LD1, His-tagged

• Cat.No.: A2LD1-26036TH
• Product Overview: Recombinant full length Human A2LD1 with an N terminal His tag; 173 amino acids with a predicted MWt 19.4kDa including tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 153 amino acids
• Description: The protein encoded by this gene aids in the proteolytic degradation of crosslinked fibrin by breaking down isodipeptide L-gamma-glutamyl-L-epsilon-lysine, a byproduct of fibrin degradation. The reaction catalyzed by the encoded gamma-glutamylaminecyclotransferase produces 5-oxo-L-proline and a free alkylamine. Two transcript variants encoding the same protein have been found for this gene.
• Conjugation: HIS
• Molecular Weight: 19.400kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEEPPAPTAVQCFVYSRATFPPEWAQLPHHDSYDSEGPHGLRYNPRENR
• Sequence Similarities: Belongs to the gamma-glutamylcyclotransferase family.

Gene Information

• Gene Name: A2LD1 AIG2-like domain 1 [ Homo sapiens ]
• Official Symbol: A2LD1
• Synonyms: A2LD1; AIG2-like domain 1; gamma-glutamylaminecyclotransferase; gamma glutamylamine cyclotransferase; GGACT
• Gene ID: 87769
• mRNA Refseq: NM_033110
• Protein Refseq: NP_149101
• MIM: 613378
• Uniprot ID: Q9BVM4
• Chromosome Location: 13q32.3
• Function: gamma-glutamylcyclotransferase activity; transferase activity, transferring acyl groups