"A2LD1" Related Products

Recombinant Human A2LD1, His-tagged

Cat.No. : A2LD1-26036TH
Product Overview : Recombinant full length Human A2LD1 with an N terminal His tag; 173 amino acids with a predicted MWt 19.4kDa including tag.
Description : The protein encoded by this gene aids in the proteolytic degradation of crosslinked fibrin by breaking down isodipeptide L-gamma-glutamyl-L-epsilon-lysine, a byproduct of fibrin degradation. The reaction catalyzed by the encoded gamma-glutamylaminecyclotransferase produces 5-oxo-L-proline and a free alkylamine. Two transcript variants encoding the same protein have been found for this gene.
Protein length : 153 amino acids
Conjugation : HIS
Molecular Weight : 19.400kDa inclusive of tags
Source : E. coli
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEEPPAPTAVQCFVYSRATFPPEWAQLPHHDSYDSEGPHGLRYNPRENR
Sequence Similarities : Belongs to the gamma-glutamylcyclotransferase family.
Gene Name : A2LD1 AIG2-like domain 1 [ Homo sapiens ]
Official Symbol : A2LD1
Synonyms : A2LD1; AIG2-like domain 1; gamma-glutamylaminecyclotransferase; gamma glutamylamine cyclotransferase; GGACT;
Gene ID : 87769
mRNA Refseq : NM_033110
Protein Refseq : NP_149101
MIM : 613378
Uniprot ID : Q9BVM4
Chromosome Location : 13q32.3
Function : gamma-glutamylcyclotransferase activity; transferase activity, transferring acyl groups;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.