Recombinant Human A2LD1, His-tagged
Cat.No. : | A2LD1-26036TH |
Product Overview : | Recombinant full length Human A2LD1 with an N terminal His tag; 173 amino acids with a predicted MWt 19.4kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 153 amino acids |
Description : | The protein encoded by this gene aids in the proteolytic degradation of crosslinked fibrin by breaking down isodipeptide L-gamma-glutamyl-L-epsilon-lysine, a byproduct of fibrin degradation. The reaction catalyzed by the encoded gamma-glutamylaminecyclotransferase produces 5-oxo-L-proline and a free alkylamine. Two transcript variants encoding the same protein have been found for this gene. |
Conjugation : | HIS |
Molecular Weight : | 19.400kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEEPPAPTAVQCFVYSRATFPPEWAQLPHHDSYDSEGPHGLRYNPRENR |
Sequence Similarities : | Belongs to the gamma-glutamylcyclotransferase family. |
Gene Name | A2LD1 AIG2-like domain 1 [ Homo sapiens ] |
Official Symbol | A2LD1 |
Synonyms | A2LD1; AIG2-like domain 1; gamma-glutamylaminecyclotransferase; gamma glutamylamine cyclotransferase; GGACT; |
Gene ID | 87769 |
mRNA Refseq | NM_033110 |
Protein Refseq | NP_149101 |
MIM | 613378 |
Uniprot ID | Q9BVM4 |
Chromosome Location | 13q32.3 |
Function | gamma-glutamylcyclotransferase activity; transferase activity, transferring acyl groups; |
◆ Recombinant Proteins | ||
A2LD1-3035H | Recombinant HUMAN A2LD1 | +Inquiry |
A2LD1-26036TH | Recombinant Human A2LD1, His-tagged | +Inquiry |
A2LD1-964H | Recombinant Human AIG2-Like Domain 1, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All A2LD1 Products
Required fields are marked with *
My Review for All A2LD1 Products
Required fields are marked with *