"A2LD1" Related Products

Recombinant Human A2LD1, His-tagged

Cat.No.: A2LD1-26036TH
Product Overview: Recombinant full length Human A2LD1 with an N terminal His tag; 173 amino acids with a predicted MWt 19.4kDa including tag.
Description: The protein encoded by this gene aids in the proteolytic degradation of crosslinked fibrin by breaking down isodipeptide L-gamma-glutamyl-L-epsilon-lysine, a byproduct of fibrin degradation. The reaction catalyzed by the encoded gamma-glutamylaminecyclotransferase produces 5-oxo-L-proline and a free alkylamine. Two transcript variants encoding the same protein have been found for this gene.
Protein length: 153 amino acids
Conjugation: HIS
Molecular Weight: 19.400kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEEPPAPTAVQCFVYSRATFPPEWAQLPHHDSYDSEGPHGLRYNPRENR
Sequence Similarities: Belongs to the gamma-glutamylcyclotransferase family.
Gene Name: A2LD1 AIG2-like domain 1 [ Homo sapiens ]
Official Symbol: A2LD1
Synonyms: A2LD1; AIG2-like domain 1; gamma-glutamylaminecyclotransferase; gamma glutamylamine cyclotransferase; GGACT;
Gene ID: 87769
mRNA Refseq: NM_033110
Protein Refseq: NP_149101
MIM: 613378
Uniprot ID: Q9BVM4
Chromosome Location: 13q32.3
Function: gamma-glutamylcyclotransferase activity; transferase activity, transferring acyl groups;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.