Recombinant Human ABCF1, His-tagged ABCF1-26041TH

Specification
Gene Information
Related Products

Cat.No.:	ABCF1-26041TH
Product Overview:	Recombinant fragment, corresponding to amino acids 474-807 of Human ABCF1 isoform 2, with a N terminal His tag; predicted MWt 39 kDa:
Description:	The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the GCN20 subfamily. Unlike other members of the superfamily, this protein lacks the transmembrane domains which are characteristic of most ABC transporters. This protein may be regulated by tumor necrosis factor-alpha and play a role in enhancement of protein synthesis and the inflammation process.
Conjugation:	HIS
Source:	E. coli
Tissue specificity:	Ubiquitous.
Form:	Lyophilised:Reconstitution with 95 μl aqua dest.
Storage buffer:	Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage:	Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids:	DDVCTDIIHLDAQRLHYYRGNYMTFKKMYQQKQKELLKQY EKQEKKLKELKAGGKSTKQAEKQTKEALTRKQQKCRRK NQDEESQEAPELLKRPKEYTVRFTFPDPPPLSPPVLGL HGVTFGYQGQKPLFKNLDFGIDMDSRICIVGPNGVGKSTL LLLLTGKLTPTHGEMRKNHRLKIGFFNQQYAEQLRMEE TPTEYLQRGFNLPYQDARKCLGRFGLESHAHTIQICKL SGGQKARVVFAELACREPDVLILDEPTNNLDIESIDALGEAINEYKGAVIVVSHDARLITETNCQLWVVEEQSVSQID GDFEDYKREVLEALGEVMVSRPRE
Sequence Similarities:	Belongs to the ABC transporter superfamily. ABCF family. EF3 subfamily.Contains 2 ABC transporter domains.

Download Datasheet

Gene Name:	ABCF1 ATP-binding cassette, sub-family F (GCN20), member 1 [ Homo sapiens ]
Official Symbol:	ABCF1
Synonyms:	ABCF1; ATP-binding cassette, sub-family F (GCN20), member 1; ABC50; ATP-binding cassette sub-family F member 1; EST123147;
Gene ID:	23
mRNA Refseq:	NM_001025091
Protein Refseq:	NP_001020262
MIM:	603429
Uniprot ID:	Q8NE71
Chromosome Location:	6p21.33
Function:	ATP binding; ATP binding; ATPase activity; nucleotide binding; protein binding;