Recombinant Human ABCF1, His-tagged
Cat.No. : | ABCF1-26041TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 474-807 of Human ABCF1 isoform 2, with a N terminal His tag; predicted MWt 39 kDa: |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 474-807 a.a. |
Description : | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the GCN20 subfamily. Unlike other members of the superfamily, this protein lacks the transmembrane domains which are characteristic of most ABC transporters. This protein may be regulated by tumor necrosis factor-alpha and play a role in enhancement of protein synthesis and the inflammation process. |
Conjugation : | HIS |
Tissue specificity : | Ubiquitous. |
Form : | Lyophilised:Reconstitution with 95 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DDVCTDIIHLDAQRLHYYRGNYMTFKKMYQQKQKELLKQY EKQEKKLKELKAGGKSTKQAEKQTKEALTRKQQKCRRK NQDEESQEAPELLKRPKEYTVRFTFPDPPPLSPPVLGL HGVTFGYQGQKPLFKNLDFGIDMDSRICIVGPNGVGKSTL LLLLTGKLTPTHGEMRKNHRLKIGFFNQQYAEQLRMEE TPTEYLQRGFNLPYQDARKCLGRFGLESHAHTIQICKL SGGQKARVVFAELACREPDVLILDEPTNNLDIESIDALGEAINEYKGAVIVVSHDARLITETNCQLWVVEEQSVSQID GDFEDYKREVLEALGEVMVSRPRE |
Sequence Similarities : | Belongs to the ABC transporter superfamily. ABCF family. EF3 subfamily.Contains 2 ABC transporter domains. |
Gene Name | ABCF1 ATP-binding cassette, sub-family F (GCN20), member 1 [ Homo sapiens ] |
Official Symbol | ABCF1 |
Synonyms | ABCF1; ATP-binding cassette, sub-family F (GCN20), member 1; ABC50; ATP-binding cassette sub-family F member 1; EST123147; |
Gene ID | 23 |
mRNA Refseq | NM_001025091 |
Protein Refseq | NP_001020262 |
MIM | 603429 |
Uniprot ID | Q8NE71 |
Chromosome Location | 6p21.33 |
Function | ATP binding; ATP binding; ATPase activity; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
ABCF1-183R | Recombinant Rhesus monkey ABCF1 Protein, His-tagged | +Inquiry |
ABCF1-26041TH | Recombinant Human ABCF1, His-tagged | +Inquiry |
ABCF1-67R | Recombinant Rat ABCF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABCF1-12398Z | Recombinant Zebrafish ABCF1 | +Inquiry |
ABCF1-412R | Recombinant Rat ABCF1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABCF1-7HCL | Recombinant Human ABCF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABCF1 Products
Required fields are marked with *
My Review for All ABCF1 Products
Required fields are marked with *
0
Inquiry Basket