"ACP1" Related Products

Expand
Expand
Expand

Recombinant Human ACP1, His-tagged

Cat.No.: ACP1-26291TH
Product Overview: Recombinant fragment, corresponding to amino acids 4-158 of Human Acid Phosphatase with a N terminal His tag; 21 kDa.
Description: The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitution with 114 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVD SAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKE DFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGS YDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Gene Name: ACP1 acid phosphatase 1, soluble [ Homo sapiens ]
Official Symbol: ACP1
Synonyms: ACP1; acid phosphatase 1, soluble; low molecular weight phosphotyrosine protein phosphatase;
Gene ID: 52
mRNA Refseq: NM_001040649
Protein Refseq: NP_001035739
MIM: 171500
Uniprot ID: P24666
Chromosome Location: 2p25
Pathway: Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; EPHA2 forward signaling, organism-specific biosystem; PDGFR-beta signaling pathway, organism-specific biosystem; Riboflavin metabolism, organism-specific biosystem;
Function: acid phosphatase activity; hydrolase activity; non-membrane spanning protein tyrosine phosphatase activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.