Recombinant Human ACP1 protein
Cat.No. : | ACP1-2477H |
Product Overview : | Recombinant Human ACP1 protein(P24666)(1-158aa), fused to Tag-Free, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 1-158aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18 kDa |
AA Sequence : | MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ACP1 acid phosphatase 1, soluble [ Homo sapiens ] |
Official Symbol | ACP1 |
Synonyms | ACP1; acid phosphatase 1, soluble; low molecular weight phosphotyrosine protein phosphatase; LMW-PTP; LMW-PTPase; adipocyte acid phosphatase; red cell acid phosphatase 1; protein tyrosine phosphatase; acid phosphatase of erythrocyte; cytoplasmic phosphotyrosyl protein phosphatase; low molecular weight cytosolic acid phosphatase; HAAP; MGC3499; MGC111030; |
Gene ID | 52 |
mRNA Refseq | NM_001040649 |
Protein Refseq | NP_001035739 |
MIM | 171500 |
UniProt ID | P24666 |
◆ Recombinant Proteins | ||
ACP1-177H | Active Recombinant Human ACP1 Protein, his-Tagged | +Inquiry |
ACP1-4867H | Recombinant Human ACP1 Protein, His tagged | +Inquiry |
Acp1-45M | Recombinant Mouse Acp1 Protein, His-tagged | +Inquiry |
CALCA-3496H | Recombinant Human CALCA protein, His-tagged | +Inquiry |
ACP1-9306H | Recombinant Human ACP1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACP1-9083HCL | Recombinant Human ACP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACP1 Products
Required fields are marked with *
My Review for All ACP1 Products
Required fields are marked with *
0
Inquiry Basket