Recombinant Human ACP1 protein
| Cat.No. : | ACP1-2477H |
| Product Overview : | Recombinant Human ACP1 protein(P24666)(1-158aa), fused to Tag-Free, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 1-158aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18 kDa |
| AA Sequence : | MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | ACP1 acid phosphatase 1, soluble [ Homo sapiens ] |
| Official Symbol | ACP1 |
| Synonyms | ACP1; acid phosphatase 1, soluble; low molecular weight phosphotyrosine protein phosphatase; LMW-PTP; LMW-PTPase; adipocyte acid phosphatase; red cell acid phosphatase 1; protein tyrosine phosphatase; acid phosphatase of erythrocyte; cytoplasmic phosphotyrosyl protein phosphatase; low molecular weight cytosolic acid phosphatase; HAAP; MGC3499; MGC111030; |
| Gene ID | 52 |
| mRNA Refseq | NM_001040649 |
| Protein Refseq | NP_001035739 |
| MIM | 171500 |
| UniProt ID | P24666 |
| ◆ Recombinant Proteins | ||
| ACP1-1567H | Recombinant Human ACP1 protein, His-tagged | +Inquiry |
| ACP1-4867H | Recombinant Human ACP1 Protein, His tagged | +Inquiry |
| Acp1-5710R | Recombinant Rat Acp1 protein, His-tagged | +Inquiry |
| ACP1-94HFL | Active Recombinant Full Length Human ACP1 Protein, N-GST-tagged | +Inquiry |
| ACP1-93HFL | Active Recombinant Full Length Human ACP1 Protein, N-GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACP1-9083HCL | Recombinant Human ACP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACP1 Products
Required fields are marked with *
My Review for All ACP1 Products
Required fields are marked with *



