Recombinant Human ACP1 protein

Cat.No. : ACP1-2477H
Product Overview : Recombinant Human ACP1 protein(P24666)(1-158aa), fused to Tag-Free, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 1-158aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 18 kDa
AA Sequence : MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name ACP1 acid phosphatase 1, soluble [ Homo sapiens ]
Official Symbol ACP1
Synonyms ACP1; acid phosphatase 1, soluble; low molecular weight phosphotyrosine protein phosphatase; LMW-PTP; LMW-PTPase; adipocyte acid phosphatase; red cell acid phosphatase 1; protein tyrosine phosphatase; acid phosphatase of erythrocyte; cytoplasmic phosphotyrosyl protein phosphatase; low molecular weight cytosolic acid phosphatase; HAAP; MGC3499; MGC111030;
Gene ID 52
mRNA Refseq NM_001040649
Protein Refseq NP_001035739
MIM 171500
UniProt ID P24666

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACP1 Products

Required fields are marked with *

My Review for All ACP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon