Recombinant Human ACSL1

PRODUCTS

Home / Products / Antibody / Recombinant Human ACSL1

Recombinant Human ACSL1

ACSL1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ACSL1-26479TH
Product Overview : Recombinant fragment: PKPLKPPCDL SMQSVEVAGS GGARRSALLD SDEPLVYFYD DVTTLYEGFQ RGIQVSNNGP CLGSRKPDQP YEWLSYKQVA ELSECIGSAL IQKGFKTA of Human ACSL1 (amino acids 48-145) with N terminal proprietary tag, 36.41 kDa.
Description : The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.
Protein length : 98 amino acids
Molecular Weight : 36.410kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Highly expressed in liver, heart, skeletal muscle, kidney and erythroid cells, and to a lesser extent in brain, lung, placenta and pancreas.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA
Sequence Similarities : Belongs to the ATP-dependent AMP-binding enzyme family.
Gene Name : ACSL1 acyl-CoA synthetase long-chain family member 1 [ Homo sapiens ]
Official Symbol : ACSL1
Synonyms : ACSL1; acyl-CoA synthetase long-chain family member 1; FACL2, fatty acid Coenzyme A ligase, long chain 2; long-chain-fatty-acid--CoA ligase 1; ACS1; FACL1; LACS; LACS1; LACS2; lignoceroyl CoA synthase; long chain fatty acid coenzyme A ligase 1;
Gene ID : 2180
mRNA Refseq : NM_001995
Protein Refseq : NP_001986
MIM : 152425
Uniprot ID : P33121
Chromosome Location : 4q35
Pathway : Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Fatty Acid Beta Oxidation, organism-specific biosystem; Fatty Acid Biosynthesis, organism-specific biosystem; Fatty Acyl-CoA Biosynthesis, organism-specific biosystem;
Function : ATP binding; ligase activity; long-chain fatty acid-CoA ligase activity; nucleotide binding;

Online Inquiry


  •  
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information
  • Note: There will be extra charge for optional service!

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.