Recombinant Human ACSL1

Cat.No. : ACSL1-26479TH
Product Overview : Recombinant fragment: PKPLKPPCDL SMQSVEVAGS GGARRSALLD SDEPLVYFYD DVTTLYEGFQ RGIQVSNNGP CLGSRKPDQP YEWLSYKQVA ELSECIGSAL IQKGFKTA of Human ACSL1 (amino acids 48-145) with N terminal proprietary tag, 36.41 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 98 amino acids
Description : The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.
Molecular Weight : 36.410kDa inclusive of tags
Tissue specificity : Highly expressed in liver, heart, skeletal muscle, kidney and erythroid cells, and to a lesser extent in brain, lung, placenta and pancreas.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA
Sequence Similarities : Belongs to the ATP-dependent AMP-binding enzyme family.
Gene Name ACSL1 acyl-CoA synthetase long-chain family member 1 [ Homo sapiens ]
Official Symbol ACSL1
Synonyms ACSL1; acyl-CoA synthetase long-chain family member 1; FACL2, fatty acid Coenzyme A ligase, long chain 2; long-chain-fatty-acid--CoA ligase 1; ACS1; FACL1; LACS; LACS1; LACS2; lignoceroyl CoA synthase; long chain fatty acid coenzyme A ligase 1;
Gene ID 2180
mRNA Refseq NM_001995
Protein Refseq NP_001986
MIM 152425
Uniprot ID P33121
Chromosome Location 4q35
Pathway Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Fatty Acid Beta Oxidation, organism-specific biosystem; Fatty Acid Biosynthesis, organism-specific biosystem; Fatty Acyl-CoA Biosynthesis, organism-specific biosystem;
Function ATP binding; ligase activity; long-chain fatty acid-CoA ligase activity; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACSL1 Products

Required fields are marked with *

My Review for All ACSL1 Products

Required fields are marked with *

0
cart-icon