Recombinant Human ACSL1
Cat.No. : | ACSL1-26479TH |
Product Overview : | Recombinant fragment: PKPLKPPCDL SMQSVEVAGS GGARRSALLD SDEPLVYFYD DVTTLYEGFQ RGIQVSNNGP CLGSRKPDQP YEWLSYKQVA ELSECIGSAL IQKGFKTA of Human ACSL1 (amino acids 48-145) with N terminal proprietary tag, 36.41 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 98 amino acids |
Description : | The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. |
Molecular Weight : | 36.410kDa inclusive of tags |
Tissue specificity : | Highly expressed in liver, heart, skeletal muscle, kidney and erythroid cells, and to a lesser extent in brain, lung, placenta and pancreas. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA |
Sequence Similarities : | Belongs to the ATP-dependent AMP-binding enzyme family. |
Gene Name | ACSL1 acyl-CoA synthetase long-chain family member 1 [ Homo sapiens ] |
Official Symbol | ACSL1 |
Synonyms | ACSL1; acyl-CoA synthetase long-chain family member 1; FACL2, fatty acid Coenzyme A ligase, long chain 2; long-chain-fatty-acid--CoA ligase 1; ACS1; FACL1; LACS; LACS1; LACS2; lignoceroyl CoA synthase; long chain fatty acid coenzyme A ligase 1; |
Gene ID | 2180 |
mRNA Refseq | NM_001995 |
Protein Refseq | NP_001986 |
MIM | 152425 |
Uniprot ID | P33121 |
Chromosome Location | 4q35 |
Pathway | Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Fatty Acid Beta Oxidation, organism-specific biosystem; Fatty Acid Biosynthesis, organism-specific biosystem; Fatty Acyl-CoA Biosynthesis, organism-specific biosystem; |
Function | ATP binding; ligase activity; long-chain fatty acid-CoA ligase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
ACSL1-1225M | Recombinant Mouse ACSL1 Protein | +Inquiry |
RFL-16079HF | Recombinant Full Length Human Long-Chain-Fatty-Acid--Coa Ligase 1(Acsl1) Protein, His-Tagged | +Inquiry |
Acsl1-52M | Recombinant Mouse Acsl1 Protein, His-tagged | +Inquiry |
RFL-16654RF | Recombinant Full Length Rat Long-Chain-Fatty-Acid--Coa Ligase 1(Acsl1) Protein, His-Tagged | +Inquiry |
ACSL1-272M | Recombinant Mouse ACSL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACSL1 Products
Required fields are marked with *
My Review for All ACSL1 Products
Required fields are marked with *