"ACTN2" Related Products

Recombinant Human ACTN2, His-tagged

Cat.No.: ACTN2-31382TH
Product Overview: Recombinant fragment, corresponding to amino acids 261-886 of Human Sarcomeric Alpha Actinin, with N terminal His tag, 626 amino acids, 72kDa, ,
Description: Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a muscle-specific, alpha actinin isoform that is expressed in both skeletal and cardiac muscles.
Conjugation: HIS
Source: E. coli
Tissue specificity: Expressed in both skeletal and cardiac muscle.
Form: Lyophilised:Reconstitution with 136 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRT IPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEK CQLEINFNTLQTKLRISNRPAFMPSEGKMVSDIAGAWQ RLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETW AYGKEQILLQKDYESASLTEVRALLRKHEAFESDLAAH QDRVEQIAAIAQELNELDYHDAVNVNDRCQKICDQWDR LGTLTQKRREALERMEKLLETIDQLHLEFAKRAAPFNN WMEGAMEDLQDMFIVHSIEEIQSLITAHEQFKATLPEADG ERQSIMAIQNEVEKVIQSYNIRISSSNPYSTVTMDELR TKWDKVKQLVPIRDQSLQEELARQHANERLRRQFAAQA NAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHIRVGW ELLLTTIARTINEVETQILTRDAKGITQEQMNEFRASF NHFDRRKNGLMDHEDFRACLISMGYDLGEAEFARIMTL VDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILAS DKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGA LDYAAFSS
Sequence Similarities: Belongs to the alpha-actinin family.Contains 1 actin-binding domain.Contains 2 CH (calponin-homology) domains.Contains 2 EF-hand domains.Contains 4 spectrin repeats.
Gene Name: ACTN2 actinin, alpha 2 [ Homo sapiens ]
Official Symbol: ACTN2
Synonyms: ACTN2; actinin, alpha 2; alpha-actinin-2;
Gene ID: 88
mRNA Refseq: NM_001103
Protein Refseq: NP_001094
MIM: 102573
Uniprot ID: P35609
Chromosome Location: 1q42-q43
Pathway: Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem;
Function: FATZ 1 binding; ZASP binding; actin binding; calcium ion binding; identical protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.