"ACTN2" Related Products

Recombinant Human ACTN2, His-tagged

Cat.No.: ACTN2-31382TH
Product Overview: Recombinant fragment, corresponding to amino acids 261-886 of Human Sarcomeric Alpha Actinin, with N terminal His tag, 626 amino acids, 72kDa, ,
Description: Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a muscle-specific, alpha actinin isoform that is expressed in both skeletal and cardiac muscles.
Conjugation: HIS
Source: E. coli
Tissue specificity: Expressed in both skeletal and cardiac muscle.
Form: Lyophilised:Reconstitution with 136 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRT IPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEK CQLEINFNTLQTKLRISNRPAFMPSEGKMVSDIAGAWQ RLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETW AYGKEQILLQKDYESASLTEVRALLRKHEAFESDLAAH QDRVEQIAAIAQELNELDYHDAVNVNDRCQKICDQWDR LGTLTQKRREALERMEKLLETIDQLHLEFAKRAAPFNN WMEGAMEDLQDMFIVHSIEEIQSLITAHEQFKATLPEADG ERQSIMAIQNEVEKVIQSYNIRISSSNPYSTVTMDELR TKWDKVKQLVPIRDQSLQEELARQHANERLRRQFAAQA NAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHIRVGW ELLLTTIARTINEVETQILTRDAKGITQEQMNEFRASF NHFDRRKNGLMDHEDFRACLISMGYDLGEAEFARIMTL VDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILAS DKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGA LDYAAFSS
Sequence Similarities: Belongs to the alpha-actinin family.Contains 1 actin-binding domain.Contains 2 CH (calponin-homology) domains.Contains 2 EF-hand domains.Contains 4 spectrin repeats.
Gene Name: ACTN2 actinin, alpha 2 [ Homo sapiens ]
Official Symbol: ACTN2
Synonyms: ACTN2; actinin, alpha 2; alpha-actinin-2;
Gene ID: 88
mRNA Refseq: NM_001103
Protein Refseq: NP_001094
MIM: 102573
Uniprot ID: P35609
Chromosome Location: 1q42-q43
Pathway: Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem;
Function: FATZ 1 binding; ZASP binding; actin binding; calcium ion binding; identical protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.