Recombinant Human ACTN2 protein, GST-tagged
Cat.No. : | ACTN2-1622H |
Product Overview : | Recombinant Human ACTN2 protein(1-301 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-301 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRTI |
Gene Name | ACTN2 actinin, alpha 2 [ Homo sapiens ] |
Official Symbol | ACTN2 |
Synonyms | ACTN2; actinin, alpha 2; alpha-actinin-2; F-actin cross-linking protein; alpha-actinin skeletal muscle; CMD1AA; |
Gene ID | 88 |
mRNA Refseq | NM_001103 |
Protein Refseq | NP_001094 |
MIM | 102573 |
UniProt ID | P35609 |
◆ Recombinant Proteins | ||
ACTN2-1622H | Recombinant Human ACTN2 protein, GST-tagged | +Inquiry |
ACTN2-5633H | Recombinant Human ACTN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Actn2-526M | Recombinant Mouse Actn2 Protein, MYC/DDK-tagged | +Inquiry |
ACTN2-271H | Recombinant Human ACTN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTN2-1023H | Recombinant Human ACTN2 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACTN2 Products
Required fields are marked with *
My Review for All ACTN2 Products
Required fields are marked with *
0
Inquiry Basket