"ACYP1" Related Products

Expand
Expand

Recombinant Human ACYP1, His-tagged

Cat.No.: ACYP1-26215TH
Product Overview: Recombinant full length Human ACYP1 (amino acids 1-99) with an N terminal His tag; 122aa, 13.6kDa.
Description: Acylphosphatase is a small cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase, on the basis of their tissue localization. This gene encodes the erythrocyte acylphosphatase isoenzyme. Alternatively spliced transcript variants that encode different proteins were identified through data analysis.
Protein length: 99 amino acids
Conjugation: HIS
Molecular Weight: 13.600kDa inclusive of tags
Source: E. coli
Tissue specificity: Organ-common type isozyme is found in many different tissues.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK
Sequence Similarities: Belongs to the acylphosphatase family.Contains 1 acylphosphatase-like domain.
Gene Name: ACYP1 acylphosphatase 1, erythrocyte (common) type [ Homo sapiens ]
Official Symbol: ACYP1
Synonyms: ACYP1; acylphosphatase 1, erythrocyte (common) type; acylphosphatase-1;
Gene ID: 97
mRNA Refseq: NM_001107
Protein Refseq: NP_001098
MIM: 600875
Uniprot ID: P07311
Chromosome Location: 14q24.3
Pathway: Pyruvate metabolism, organism-specific biosystem; Pyruvate metabolism, conserved biosystem;
Function: acylphosphatase activity; hydrolase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.