Recombinant Human ACYP1, His-tagged
Cat.No. : | ACYP1-26215TH |
Product Overview : | Recombinant full length Human ACYP1 (amino acids 1-99) with an N terminal His tag; 122aa, 13.6kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 99 amino acids |
Description : | Acylphosphatase is a small cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase, on the basis of their tissue localization. This gene encodes the erythrocyte acylphosphatase isoenzyme. Alternatively spliced transcript variants that encode different proteins were identified through data analysis. |
Conjugation : | HIS |
Molecular Weight : | 13.600kDa inclusive of tags |
Tissue specificity : | Organ-common type isozyme is found in many different tissues. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK |
Sequence Similarities : | Belongs to the acylphosphatase family.Contains 1 acylphosphatase-like domain. |
Gene Name | ACYP1 acylphosphatase 1, erythrocyte (common) type [ Homo sapiens ] |
Official Symbol | ACYP1 |
Synonyms | ACYP1; acylphosphatase 1, erythrocyte (common) type; acylphosphatase-1; |
Gene ID | 97 |
mRNA Refseq | NM_001107 |
Protein Refseq | NP_001098 |
MIM | 600875 |
Uniprot ID | P07311 |
Chromosome Location | 14q24.3 |
Pathway | Pyruvate metabolism, organism-specific biosystem; Pyruvate metabolism, conserved biosystem; |
Function | acylphosphatase activity; hydrolase activity; |
◆ Recombinant Proteins | ||
ACYP1-264H | Recombinant Human ACYP1 Protein, GST-tagged | +Inquiry |
Acyp1-3145M | Recombinant Mouse Acyp1, GST-tagged | +Inquiry |
ACYP1-2929H | Recombinant Human ACYP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ACYP1-838HF | Recombinant Full Length Human ACYP1 Protein, GST-tagged | +Inquiry |
ACYP1-0489H | Recombinant Human ACYP1 Protein (Met1-Lys99), N-GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACYP1-9042HCL | Recombinant Human ACYP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACYP1 Products
Required fields are marked with *
My Review for All ACYP1 Products
Required fields are marked with *