Recombinant Human ACYP1 Protein, GST-tagged
Cat.No. : | ACYP1-264H |
Product Overview : | Human ACYP1 full-length ORF ( AAH35568, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the acylphosphatase family. The encoded protein is a small cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two isoenzymes have been isolated and described based on their tissue localization: erythrocyte (common) type acylphosphatase encoded by this gene, and muscle type acylphosphatase. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACYP1 acylphosphatase 1, erythrocyte (common) type [ Homo sapiens ] |
Official Symbol | ACYP1 |
Synonyms | ACYP1; acylphosphatase 1, erythrocyte (common) type; acylphosphatase-1; acylphosphate phosphohydrolase 1; acylphosphatase, erythrocyte isozyme; acylphosphatase, organ-common type isozyme; ACYPE; |
Gene ID | 97 |
mRNA Refseq | NM_001107 |
Protein Refseq | NP_001098 |
MIM | 600875 |
UniProt ID | P07311 |
◆ Recombinant Proteins | ||
ACYP1-4037C | Recombinant Chicken ACYP1 | +Inquiry |
ACYP1-264H | Recombinant Human ACYP1 Protein, GST-tagged | +Inquiry |
ACYP1-301M | Recombinant Mouse ACYP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACYP1-0489H | Recombinant Human ACYP1 Protein (Met1-Lys99), N-GST-tagged | +Inquiry |
ACYP1-2929H | Recombinant Human ACYP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACYP1-9042HCL | Recombinant Human ACYP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACYP1 Products
Required fields are marked with *
My Review for All ACYP1 Products
Required fields are marked with *