"AES" Related Products

Expand
Expand
Expand

Recombinant Human AES, His-tagged

Cat.No.: AES-27927TH
Product Overview: Recombinant full length Human GRG with an N terminal His tag; 217 amino acids with a predicted MWt 24.1 kDa including tag.
Description: The protein encoded by this gene is similar in sequence to the amino terminus of Drosophila enhancer of split groucho, a protein involved in neurogenesis during embryonic development. The encoded protein, which belongs to the groucho/TLE family of proteins, can function as a homooligomer or as a heteroologimer with other family members to dominantly repress the expression of other family member genes. Three transcript variants encoding different isoforms have been found for this gene.
Protein length: 197 amino acids
Conjugation: HIS
Molecular Weight: 24.100kDa inclusive of tags
Source: E. coli
Tissue specificity: Found predominantly in muscle, heart and Placenta. In fetal tissues, abundantly expressed in the heart, lung, kidney, brain and liver.
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSD
Sequence Similarities: Belongs to the WD repeat Groucho/TLE family.
Gene Name: AES amino-terminal enhancer of split [ Homo sapiens ]
Official Symbol: AES
Synonyms: AES; amino-terminal enhancer of split; GRG5; TLE5;
Gene ID: 166
mRNA Refseq: NM_001130
Protein Refseq: NP_001121
MIM: 600188
Uniprot ID: Q08117
Chromosome Location: 19p13.3
Pathway: Androgen Receptor Signaling Pathway, organism-specific biosystem; Presenilin action in Notch and Wnt signaling, organism-specific biosystem; Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem;
Function: protein binding; transcription corepressor activity; transcription corepressor activity; transcription corepressor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.