"AES" Related Products

Expand
Expand
Expand

Recombinant Human AES, His-tagged

Cat.No.: AES-27927TH
Product Overview: Recombinant full length Human GRG with an N terminal His tag; 217 amino acids with a predicted MWt 24.1 kDa including tag.
Description: The protein encoded by this gene is similar in sequence to the amino terminus of Drosophila enhancer of split groucho, a protein involved in neurogenesis during embryonic development. The encoded protein, which belongs to the groucho/TLE family of proteins, can function as a homooligomer or as a heteroologimer with other family members to dominantly repress the expression of other family member genes. Three transcript variants encoding different isoforms have been found for this gene.
Protein length: 197 amino acids
Conjugation: HIS
Molecular Weight: 24.100kDa inclusive of tags
Source: E. coli
Tissue specificity: Found predominantly in muscle, heart and Placenta. In fetal tissues, abundantly expressed in the heart, lung, kidney, brain and liver.
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSD
Sequence Similarities: Belongs to the WD repeat Groucho/TLE family.
Gene Name: AES amino-terminal enhancer of split [ Homo sapiens ]
Official Symbol: AES
Synonyms: AES; amino-terminal enhancer of split; GRG5; TLE5;
Gene ID: 166
mRNA Refseq: NM_001130
Protein Refseq: NP_001121
MIM: 600188
Uniprot ID: Q08117
Chromosome Location: 19p13.3
Pathway: Androgen Receptor Signaling Pathway, organism-specific biosystem; Presenilin action in Notch and Wnt signaling, organism-specific biosystem; Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem;
Function: protein binding; transcription corepressor activity; transcription corepressor activity; transcription corepressor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.