Recombinant Human AES, His-tagged

Cat.No. : AES-27927TH
Product Overview : Recombinant full length Human GRG with an N terminal His tag; 217 amino acids with a predicted MWt 24.1 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 197 amino acids
Description : The protein encoded by this gene is similar in sequence to the amino terminus of Drosophila enhancer of split groucho, a protein involved in neurogenesis during embryonic development. The encoded protein, which belongs to the groucho/TLE family of proteins, can function as a homooligomer or as a heteroologimer with other family members to dominantly repress the expression of other family member genes. Three transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Molecular Weight : 24.100kDa inclusive of tags
Tissue specificity : Found predominantly in muscle, heart and Placenta. In fetal tissues, abundantly expressed in the heart, lung, kidney, brain and liver.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSD
Sequence Similarities : Belongs to the WD repeat Groucho/TLE family.
Gene Name AES amino-terminal enhancer of split [ Homo sapiens ]
Official Symbol AES
Synonyms AES; amino-terminal enhancer of split; GRG5; TLE5;
Gene ID 166
mRNA Refseq NM_001130
Protein Refseq NP_001121
MIM 600188
Uniprot ID Q08117
Chromosome Location 19p13.3
Pathway Androgen Receptor Signaling Pathway, organism-specific biosystem; Presenilin action in Notch and Wnt signaling, organism-specific biosystem; Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem;
Function protein binding; transcription corepressor activity; transcription corepressor activity; transcription corepressor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AES Products

Required fields are marked with *

My Review for All AES Products

Required fields are marked with *

0
cart-icon
0
compare icon