Recombinant Human AES, His-tagged

• Cat.No.: AES-27927TH
• Product Overview: Recombinant full length Human GRG with an N terminal His tag; 217 amino acids with a predicted MWt 24.1 kDa including tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 197 amino acids
• Description: The protein encoded by this gene is similar in sequence to the amino terminus of Drosophila enhancer of split groucho, a protein involved in neurogenesis during embryonic development. The encoded protein, which belongs to the groucho/TLE family of proteins, can function as a homooligomer or as a heteroologimer with other family members to dominantly repress the expression of other family member genes. Three transcript variants encoding different isoforms have been found for this gene.
• Conjugation: HIS
• Molecular Weight: 24.100kDa inclusive of tags
• Tissue specificity: Found predominantly in muscle, heart and Placenta. In fetal tissues, abundantly expressed in the heart, lung, kidney, brain and liver.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSD
• Sequence Similarities: Belongs to the WD repeat Groucho/TLE family.

Gene Information

• Gene Name: AES amino-terminal enhancer of split [ Homo sapiens ]
• Official Symbol: AES
• Synonyms: AES; amino-terminal enhancer of split; GRG5; TLE5
• Gene ID: 166
• mRNA Refseq: NM_001130
• Protein Refseq: NP_001121
• MIM: 600188
• Uniprot ID: Q08117
• Chromosome Location: 19p13.3
• Pathway: Androgen Receptor Signaling Pathway, organism-specific biosystem; Presenilin action in Notch and Wnt signaling, organism-specific biosystem; Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem
• Function: protein binding; transcription corepressor activity; transcription corepressor activity; transcription corepressor activity