Recombinant Human AES, His-tagged
Cat.No. : | AES-27927TH |
Product Overview : | Recombinant full length Human GRG with an N terminal His tag; 217 amino acids with a predicted MWt 24.1 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 197 amino acids |
Description : | The protein encoded by this gene is similar in sequence to the amino terminus of Drosophila enhancer of split groucho, a protein involved in neurogenesis during embryonic development. The encoded protein, which belongs to the groucho/TLE family of proteins, can function as a homooligomer or as a heteroologimer with other family members to dominantly repress the expression of other family member genes. Three transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Molecular Weight : | 24.100kDa inclusive of tags |
Tissue specificity : | Found predominantly in muscle, heart and Placenta. In fetal tissues, abundantly expressed in the heart, lung, kidney, brain and liver. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSD |
Sequence Similarities : | Belongs to the WD repeat Groucho/TLE family. |
Gene Name | AES amino-terminal enhancer of split [ Homo sapiens ] |
Official Symbol | AES |
Synonyms | AES; amino-terminal enhancer of split; GRG5; TLE5; |
Gene ID | 166 |
mRNA Refseq | NM_001130 |
Protein Refseq | NP_001121 |
MIM | 600188 |
Uniprot ID | Q08117 |
Chromosome Location | 19p13.3 |
Pathway | Androgen Receptor Signaling Pathway, organism-specific biosystem; Presenilin action in Notch and Wnt signaling, organism-specific biosystem; Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem; |
Function | protein binding; transcription corepressor activity; transcription corepressor activity; transcription corepressor activity; |
◆ Recombinant Proteins | ||
AES-552R | Recombinant Rat AES Protein | +Inquiry |
Aes-3423M | Recombinant Mouse Aes, His-tagged | +Inquiry |
AES-1396M | Recombinant Mouse AES Protein | +Inquiry |
AES-397H | Recombinant Human AES Protein, GST-tagged | +Inquiry |
AES-282C | Recombinant Cynomolgus AES Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AES-8991HCL | Recombinant Human AES 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AES Products
Required fields are marked with *
My Review for All AES Products
Required fields are marked with *