Recombinant Human AES Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | AES-1497H |
Product Overview : | AES MS Standard C13 and N15-labeled recombinant protein (NP_001121) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is similar in sequence to the amino terminus of Drosophila enhancer of split groucho, a protein involved in neurogenesis during embryonic development. The encoded protein, which belongs to the groucho/TLE family of proteins, can function as a homooligomer or as a heteroologimer with other family members to dominantly repress the expression of other family member genes. Three transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 21.8 kDa |
AA Sequence : | MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | AES amino-terminal enhancer of split [ Homo sapiens (human) ] |
Official Symbol | AES |
Synonyms | AES; amino-terminal enhancer of split; GRG5; TLE5; gp130-associated protein GAM; GRG; ESP1; AES-1; AES-2; |
Gene ID | 166 |
mRNA Refseq | NM_001130 |
Protein Refseq | NP_001121 |
MIM | 600188 |
UniProt ID | Q08117 |
◆ Recombinant Proteins | ||
AES-301324H | Recombinant Human AES protein, GST-tagged | +Inquiry |
AES-985HF | Recombinant Full Length Human AES Protein, GST-tagged | +Inquiry |
AES-373M | Recombinant Mouse AES Protein, His (Fc)-Avi-tagged | +Inquiry |
AES-10734Z | Recombinant Zebrafish AES | +Inquiry |
AES-208R | Recombinant Rat AES Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AES-8991HCL | Recombinant Human AES 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AES Products
Required fields are marked with *
My Review for All AES Products
Required fields are marked with *
0
Inquiry Basket