"AFF2" Related Products

Recombinant Human AFF2

Cat.No.: AFF2-26444TH
Product Overview: Recombinant fragment of Human AFF2 with N terminal proprietary tag. Predicted MW 37.84 kDa.
Description: This gene encodes a putative transcriptional activator that is a member of the AF4\FMR2 gene family. This gene is associated with the folate-sensitive fragile X E locus on chromosome X. A repeat polymorphism in the fragile X E locus results in silencing of this gene causing Fragile X E syndrome. Fragile X E syndrome is a form of nonsyndromic X-linked mental retardation. Alternate splicing results in multiple transcript variants.
Protein length: 111 amino acids
Molecular Weight: 37.840kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Brain (most abundant in hippocampus and amygdala), placenta and lung.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KNEPSFFPEQKNRIIPPHQDNTHPSAPMPPPSVVILNSTL IHSNRKSKPEWSRDSHNPSTVLASQASGQPNKMQTLTQDQ SQAKLEDFFVYPAEQPQIGEVEESNPSAKED
Sequence Similarities: Belongs to the AF4 family.
Gene Name: AFF2 AF4/FMR2 family, member 2 [ Homo sapiens ]
Official Symbol: AFF2
Synonyms: AFF2; AF4/FMR2 family, member 2; FMR2, fragile X mental retardation 2; AF4/FMR2 family member 2; FRAXE;
Gene ID: 2334
mRNA Refseq: NM_001169122
Protein Refseq: NP_001162593
MIM: 300806
Uniprot ID: P51816
Chromosome Location: Xq28
Function: G-quadruplex RNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.