Recombinant Human AFF2 Protein, GST-tagged

Cat.No. : AFF2-406H
Product Overview : Human AFF2 partial ORF ( NP_002016.1, 109 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a putative transcriptional activator that is a member of the AF4\FMR2 gene family. This gene is associated with the folate-sensitive fragile X E locus on chromosome X. A repeat polymorphism in the fragile X E locus results in silencing of this gene causing Fragile X E syndrome. Fragile X E syndrome is a form of nonsyndromic X-linked mental retardation. In addition, this gene contains 6-25 GCC repeats that are expanded to >200 repeats in the disease state. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Jul 2016]
Molecular Mass : 37.95 kDa
AA Sequence : KNEPSFFPEQKNRIIPPHQDNTHPSAPMPPPSVVILNSTLIHSNRKSKPEWSRDSHNPSTVLASQASGQPNKMQTLTQDQSQAKLEDFFVYPAEQPQIGEVEESNPSAKED
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AFF2 AF4/FMR2 family, member 2 [ Homo sapiens ]
Official Symbol AFF2
Synonyms AFF2; AF4/FMR2 family, member 2; FMR2, fragile X mental retardation 2; AF4/FMR2 family member 2; FRAXE; protein FMR-2; fragile X mental retardation 2 protein; fragile X E mental retardation syndrome protein; FMR2; MRX2; OX19; FMR2P;
Gene ID 2334
mRNA Refseq NM_001169122
Protein Refseq NP_001162593
MIM 300806
UniProt ID P51816

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AFF2 Products

Required fields are marked with *

My Review for All AFF2 Products

Required fields are marked with *

0
cart-icon