Recombinant Human AFF2 Protein, GST-tagged
Cat.No. : | AFF2-406H |
Product Overview : | Human AFF2 partial ORF ( NP_002016.1, 109 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a putative transcriptional activator that is a member of the AF4\FMR2 gene family. This gene is associated with the folate-sensitive fragile X E locus on chromosome X. A repeat polymorphism in the fragile X E locus results in silencing of this gene causing Fragile X E syndrome. Fragile X E syndrome is a form of nonsyndromic X-linked mental retardation. In addition, this gene contains 6-25 GCC repeats that are expanded to >200 repeats in the disease state. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Jul 2016] |
Molecular Mass : | 37.95 kDa |
AA Sequence : | KNEPSFFPEQKNRIIPPHQDNTHPSAPMPPPSVVILNSTLIHSNRKSKPEWSRDSHNPSTVLASQASGQPNKMQTLTQDQSQAKLEDFFVYPAEQPQIGEVEESNPSAKED |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AFF2 AF4/FMR2 family, member 2 [ Homo sapiens ] |
Official Symbol | AFF2 |
Synonyms | AFF2; AF4/FMR2 family, member 2; FMR2, fragile X mental retardation 2; AF4/FMR2 family member 2; FRAXE; protein FMR-2; fragile X mental retardation 2 protein; fragile X E mental retardation syndrome protein; FMR2; MRX2; OX19; FMR2P; |
Gene ID | 2334 |
mRNA Refseq | NM_001169122 |
Protein Refseq | NP_001162593 |
MIM | 300806 |
UniProt ID | P51816 |
◆ Recombinant Proteins | ||
AFF2-375M | Recombinant Mouse AFF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AFF2-406H | Recombinant Human AFF2 Protein, GST-tagged | +Inquiry |
AFF2-1399M | Recombinant Mouse AFF2 Protein | +Inquiry |
AFF2-26444TH | Recombinant Human AFF2 | +Inquiry |
Aff2-3231M | Recombinant Mouse Aff2, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AFF2 Products
Required fields are marked with *
My Review for All AFF2 Products
Required fields are marked with *
0
Inquiry Basket