Recombinant Human AFF2 Protein, GST-tagged

• Cat.No.: AFF2-406H
• Product Overview: Human AFF2 partial ORF ( NP_002016.1, 109 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a putative transcriptional activator that is a member of the AF4\FMR2 gene family. This gene is associated with the folate-sensitive fragile X E locus on chromosome X. A repeat polymorphism in the fragile X E locus results in silencing of this gene causing Fragile X E syndrome. Fragile X E syndrome is a form of nonsyndromic X-linked mental retardation. In addition, this gene contains 6-25 GCC repeats that are expanded to >200 repeats in the disease state. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Jul 2016]
• Molecular Mass: 37.95 kDa
• AA Sequence: KNEPSFFPEQKNRIIPPHQDNTHPSAPMPPPSVVILNSTLIHSNRKSKPEWSRDSHNPSTVLASQASGQPNKMQTLTQDQSQAKLEDFFVYPAEQPQIGEVEESNPSAKED
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AFF2 AF4/FMR2 family, member 2 [ Homo sapiens ]
• Official Symbol: AFF2
• Synonyms: AFF2; AF4/FMR2 family, member 2; FMR2, fragile X mental retardation 2; AF4/FMR2 family member 2; FRAXE; protein FMR-2; fragile X mental retardation 2 protein; fragile X E mental retardation syndrome protein; FMR2; MRX2; OX19; FMR2P
• Gene ID: 2334
• mRNA Refseq: NM_001169122
• Protein Refseq: NP_001162593
• MIM: 300806
• UniProt ID: P51816