Recombinant Human AFF2
Cat.No. : | AFF2-26444TH |
Product Overview : | Recombinant fragment of Human AFF2 with N terminal proprietary tag. Predicted MW 37.84 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 111 amino acids |
Description : | This gene encodes a putative transcriptional activator that is a member of the AF4\FMR2 gene family. This gene is associated with the folate-sensitive fragile X E locus on chromosome X. A repeat polymorphism in the fragile X E locus results in silencing of this gene causing Fragile X E syndrome. Fragile X E syndrome is a form of nonsyndromic X-linked mental retardation. Alternate splicing results in multiple transcript variants. |
Molecular Weight : | 37.840kDa inclusive of tags |
Tissue specificity : | Brain (most abundant in hippocampus and amygdala), placenta and lung. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KNEPSFFPEQKNRIIPPHQDNTHPSAPMPPPSVVILNSTL IHSNRKSKPEWSRDSHNPSTVLASQASGQPNKMQTLTQDQ SQAKLEDFFVYPAEQPQIGEVEESNPSAKED |
Sequence Similarities : | Belongs to the AF4 family. |
Gene Name | AFF2 AF4/FMR2 family, member 2 [ Homo sapiens ] |
Official Symbol | AFF2 |
Synonyms | AFF2; AF4/FMR2 family, member 2; FMR2, fragile X mental retardation 2; AF4/FMR2 family member 2; FRAXE; |
Gene ID | 2334 |
mRNA Refseq | NM_001169122 |
Protein Refseq | NP_001162593 |
MIM | 300806 |
Uniprot ID | P51816 |
Chromosome Location | Xq28 |
Function | G-quadruplex RNA binding; |
◆ Recombinant Proteins | ||
AFF2-26444TH | Recombinant Human AFF2 | +Inquiry |
AFF2-375M | Recombinant Mouse AFF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AFF2-1399M | Recombinant Mouse AFF2 Protein | +Inquiry |
AFF2-406H | Recombinant Human AFF2 Protein, GST-tagged | +Inquiry |
Aff2-3231M | Recombinant Mouse Aff2, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AFF2 Products
Required fields are marked with *
My Review for All AFF2 Products
Required fields are marked with *
0
Inquiry Basket