Recombinant Human AFF2

• Cat.No.: AFF2-26444TH
• Product Overview: Recombinant fragment of Human AFF2 with N terminal proprietary tag. Predicted MW 37.84 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 111 amino acids
• Description: This gene encodes a putative transcriptional activator that is a member of the AF4\FMR2 gene family. This gene is associated with the folate-sensitive fragile X E locus on chromosome X. A repeat polymorphism in the fragile X E locus results in silencing of this gene causing Fragile X E syndrome. Fragile X E syndrome is a form of nonsyndromic X-linked mental retardation. Alternate splicing results in multiple transcript variants.
• Molecular Weight: 37.840kDa inclusive of tags
• Tissue specificity: Brain (most abundant in hippocampus and amygdala), placenta and lung.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KNEPSFFPEQKNRIIPPHQDNTHPSAPMPPPSVVILNSTL IHSNRKSKPEWSRDSHNPSTVLASQASGQPNKMQTLTQDQ SQAKLEDFFVYPAEQPQIGEVEESNPSAKED
• Sequence Similarities: Belongs to the AF4 family.

Gene Information

• Gene Name: AFF2 AF4/FMR2 family, member 2 [ Homo sapiens ]
• Official Symbol: AFF2
• Synonyms: AFF2; AF4/FMR2 family, member 2; FMR2, fragile X mental retardation 2; AF4/FMR2 family member 2; FRAXE
• Gene ID: 2334
• mRNA Refseq: NM_001169122
• Protein Refseq: NP_001162593
• MIM: 300806
• Uniprot ID: P51816
• Chromosome Location: Xq28
• Function: G-quadruplex RNA binding