Recombinant Human AFF2

Species :	Human
Source :	Wheat Germ
Tag :	Non
Protein Length :	111 amino acids
Description :	This gene encodes a putative transcriptional activator that is a member of the AF4\FMR2 gene family. This gene is associated with the folate-sensitive fragile X E locus on chromosome X. A repeat polymorphism in the fragile X E locus results in silencing of this gene causing Fragile X E syndrome. Fragile X E syndrome is a form of nonsyndromic X-linked mental retardation. Alternate splicing results in multiple transcript variants.
Molecular Weight :	37.840kDa inclusive of tags
Tissue specificity :	Brain (most abundant in hippocampus and amygdala), placenta and lung.
Form :	Liquid
Purity :	Proprietary Purification
Storage buffer :	pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	KNEPSFFPEQKNRIIPPHQDNTHPSAPMPPPSVVILNSTL IHSNRKSKPEWSRDSHNPSTVLASQASGQPNKMQTLTQDQ SQAKLEDFFVYPAEQPQIGEVEESNPSAKED
Sequence Similarities :	Belongs to the AF4 family.

Gene Name	AFF2 AF4/FMR2 family, member 2 [ Homo sapiens ]
Official Symbol	AFF2
Synonyms	AFF2; AF4/FMR2 family, member 2; FMR2, fragile X mental retardation 2; AF4/FMR2 family member 2; FRAXE;
Gene ID	2334
mRNA Refseq	NM_001169122
Protein Refseq	NP_001162593
MIM	300806
Uniprot ID	P51816
Chromosome Location	Xq28
Function	G-quadruplex RNA binding;