Recombinant Human AHR

Cat.No. : AHR-26266TH
Product Overview : Recombinant fragment corresponding to amino acids 721-820 of Human Aryl hydrocarbon Receptor, with a proprietary tag. Predicted MWt 36.63kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Its ligands included a variety of aromatic hydrocarbons.
Molecular Weight : 36.630kDa
Tissue specificity : Expressed in all tissues tested including blood, brain, heart, kidney, liver, lung, pancreas and skeletal muscle.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN
Sequence Similarities : Contains 1 basic helix-loop-helix (bHLH) domain.Contains 1 PAC (PAS-associated C-terminal) domain.Contains 2 PAS (PER-ARNT-SIM) domains.
Gene Name AHR aryl hydrocarbon receptor [ Homo sapiens ]
Official Symbol AHR
Synonyms AHR; aryl hydrocarbon receptor; bHLHe76;
Gene ID 196
mRNA Refseq NM_001621
Protein Refseq NP_001612
MIM 600253
Uniprot ID P35869
Chromosome Location 7p15
Pathway Adipogenesis, organism-specific biosystem;
Function DNA binding; DNA binding; Hsp90 protein binding; ligand-dependent nuclear receptor activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AHR Products

Required fields are marked with *

My Review for All AHR Products

Required fields are marked with *

0
cart-icon
0
compare icon