"AHR" Related Products

Expand
Expand

Recombinant Human AHR

Cat.No.: AHR-26266TH
Product Overview: Recombinant fragment corresponding to amino acids 721-820 of Human Aryl hydrocarbon Receptor, with a proprietary tag. Predicted MWt 36.63kDa inclusive of tag.
Description: This gene encodes a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Its ligands included a variety of aromatic hydrocarbons.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa
Source: Wheat germ
Tissue specificity: Expressed in all tissues tested including blood, brain, heart, kidney, liver, lung, pancreas and skeletal muscle.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN
Sequence Similarities: Contains 1 basic helix-loop-helix (bHLH) domain.Contains 1 PAC (PAS-associated C-terminal) domain.Contains 2 PAS (PER-ARNT-SIM) domains.
Gene Name: AHR aryl hydrocarbon receptor [ Homo sapiens ]
Official Symbol: AHR
Synonyms: AHR; aryl hydrocarbon receptor; bHLHe76;
Gene ID: 196
mRNA Refseq: NM_001621
Protein Refseq: NP_001612
MIM: 600253
Uniprot ID: P35869
Chromosome Location: 7p15
Pathway: Adipogenesis, organism-specific biosystem;
Function: DNA binding; DNA binding; Hsp90 protein binding; ligand-dependent nuclear receptor activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.