"ALAD" Related Products

Expand
Expand

Recombinant Human ALAD, His-tagged

Cat.No.: ALAD-26880TH
Product Overview: Recombinant fragment, corresponding to amino acids 1-226 of Human ALAD with N terminal His tag; MWt 26kDa.
Description: The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 109 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MQPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDV PDDIQPITSLPGVARYGVKRLEEMLRPLVEEGLRCVLI FGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLL VACDVCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVA LAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVM SYSAKFASCFYGPFRDAAKSSPAFGDRRCYQL
Gene Name: ALAD aminolevulinate dehydratase [ Homo sapiens ]
Official Symbol: ALAD
Synonyms: ALAD; aminolevulinate dehydratase; aminolevulinate, delta , dehydratase; delta-aminolevulinic acid dehydratase; ALADH; PBGS; porphobilinogen synthase;
Gene ID: 210
mRNA Refseq: NM_000031
Protein Refseq: NP_000022
MIM: 125270
Uniprot ID: P13716
Chromosome Location: 9q32
Pathway: Heme Biosynthesis, organism-specific biosystem; Heme biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of porphyrins, organism-specific biosystem;
Function: catalytic activity; identical protein binding; lead ion binding; lyase activity; porphobilinogen synthase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.