Recombinant Human ALAD, His-tagged

• Cat.No.: ALAD-26880TH
• Product Overview: Recombinant fragment, corresponding to amino acids 1-226 of Human ALAD with N terminal His tag; MWt 26kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-226 a.a.
• Description: The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 109 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MQPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDV PDDIQPITSLPGVARYGVKRLEEMLRPLVEEGLRCVLI FGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLL VACDVCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVA LAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVM SYSAKFASCFYGPFRDAAKSSPAFGDRRCYQL

Gene Information

• Gene Name: ALAD aminolevulinate dehydratase [ Homo sapiens ]
• Official Symbol: ALAD
• Synonyms: ALAD; aminolevulinate dehydratase; aminolevulinate, delta , dehydratase; delta-aminolevulinic acid dehydratase; ALADH; PBGS; porphobilinogen synthase
• Gene ID: 210
• mRNA Refseq: NM_000031
• Protein Refseq: NP_000022
• MIM: 125270
• Uniprot ID: P13716
• Chromosome Location: 9q32
• Pathway: Heme Biosynthesis, organism-specific biosystem; Heme biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of porphyrins, organism-specific biosystem
• Function: catalytic activity; identical protein binding; lead ion binding; lyase activity; porphobilinogen synthase activity