"APAF1" Related Products

Expand
Expand
Expand

Recombinant Human APAF1

Cat.No.: APAF1-27358TH
Product Overview: Recombinant fragment corresponding to amino acids 1138-1237 Human APAF1, with a proprietary tag; predicted MWt 36.63kDa inclusive of tag.
Description: This gene encodes a cytoplasmic protein that initiates apoptosis. This protein contains several copies of the WD-40 domain, a caspase recruitment domain (CARD), and an ATPase domain (NB-ARC). Upon binding cytochrome c and dATP, this protein forms an oligomeric apoptosome. The apoptosome binds and cleaves caspase 9 preproprotein, releasing its mature, activated form. Activated caspase 9 stimulates the subsequent caspase cascade that commits the cell to apoptosis. Alternative splicing results in several transcript variants encoding different isoforms.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Ubiquitous. Highest levels of expression in adult spleen and peripheral blood leukocytes, and in fetal brain, kidney and lung. Isoform 1 is expressed in heart, kidney and liver.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIKWWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE
Sequence Similarities: Contains 1 CARD domain.Contains 1 NB-ARC domain.Contains 13 WD repeats.
Gene Name: APAF1 apoptotic peptidase activating factor 1 [ Homo sapiens ]
Official Symbol: APAF1
Synonyms: APAF1; apoptotic peptidase activating factor 1; apoptotic peptidase activating factor , apoptotic protease activating factor; apoptotic protease-activating factor 1; APAF 1; CED4;
Gene ID: 317
mRNA Refseq: NM_001160
Protein Refseq: NP_001151
MIM: 602233
Uniprot ID: O14727
Chromosome Location: 12q23
Pathway: Activation of caspases through apoptosome-mediated cleavage, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem;
Function: ADP binding; ATP binding; cysteine-type endopeptidase activator activity involved in apoptotic process; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.