Recombinant Human APAF1

• Cat.No.: APAF1-27358TH
• Product Overview: Recombinant fragment corresponding to amino acids 1138-1237 Human APAF1, with a proprietary tag; predicted MWt 36.63kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes a cytoplasmic protein that initiates apoptosis. This protein contains several copies of the WD-40 domain, a caspase recruitment domain (CARD), and an ATPase domain (NB-ARC). Upon binding cytochrome c and dATP, this protein forms an oligomeric apoptosome. The apoptosome binds and cleaves caspase 9 preproprotein, releasing its mature, activated form. Activated caspase 9 stimulates the subsequent caspase cascade that commits the cell to apoptosis. Alternative splicing results in several transcript variants encoding different isoforms.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Ubiquitous. Highest levels of expression in adult spleen and peripheral blood leukocytes, and in fetal brain, kidney and lung. Isoform 1 is expressed in heart, kidney and liver.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIKWWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE
• Sequence Similarities: Contains 1 CARD domain.Contains 1 NB-ARC domain.Contains 13 WD repeats.

Gene Information

• Gene Name: APAF1 apoptotic peptidase activating factor 1 [ Homo sapiens ]
• Official Symbol: APAF1
• Synonyms: APAF1; apoptotic peptidase activating factor 1; apoptotic peptidase activating factor , apoptotic protease activating factor; apoptotic protease-activating factor 1; APAF 1; CED4
• Gene ID: 317
• mRNA Refseq: NM_001160
• Protein Refseq: NP_001151
• MIM: 602233
• Uniprot ID: O14727
• Chromosome Location: 12q23
• Pathway: Activation of caspases through apoptosome-mediated cleavage, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem
• Function: ADP binding; ATP binding; cysteine-type endopeptidase activator activity involved in apoptotic process; nucleotide binding; protein binding