Recombinant Human APAF1 protein, GST-tagged

• Cat.No.: APAF1-665H
• Product Overview: Human APAF1 partial ORF ( NP_037361, 1138 a.a. - 1237 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a cytoplasmic protein that initiates apoptosis. This protein contains several copies of the WD-40 domain, a caspase recruitment domain (CARD), and an ATPase domain (NB-ARC). Upon binding cytochrome c and dATP, this protein forms an oligomeric apoptosome. The apoptosome binds and cleaves caspase 9 preproprotein, releasing its mature, activated form. Activated caspase 9 stimulates the subsequent caspase cascade that commits the cell to apoptosis. Alternative splicing results in several transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
• Molecular Mass: 36.85 kDa
• AA Sequence: GEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIKWWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: APAF1 apoptotic peptidase activating factor 1 [ Homo sapiens ]
• Official Symbol: APAF1
• Synonyms: APAF1; apoptotic peptidase activating factor 1; apoptotic peptidase activating factor , apoptotic protease activating factor; apoptotic protease-activating factor 1; APAF 1; CED4; APAF-1; DKFZp781B1145
• Gene ID: 317
• mRNA Refseq: NM_001160
• Protein Refseq: NP_001151
• MIM: 602233
• UniProt ID: O14727