"APLP1" Related Products

Expand

Recombinant Human APLP1, His-tagged

Cat.No.: APLP1-26119TH
Product Overview: Recombinant fragment, corresponding to amino acids 274-651 of Human APLP1 with an N-terminal His tag; Predicted MWt 43 kDa.
Description: This gene encodes a member of the highly conserved amyloid precursor protein gene family. The encoded protein is a membrane-associated glycoprotein that is cleaved by secretases in a manner similar to amyloid beta A4 precursor protein cleavage. This cleavage liberates an intracellular cytoplasmic fragment that may act as a transcriptional activator. The encoded protein may also play a role in synaptic maturation during cortical development. Alternatively spliced transcript variants encoding different isoforms have been described.
Conjugation: HIS
Source: E. coli
Tissue specificity: Expressed in the cerebral cortex where it is localized to the postsynaptic density (PSD).
Form: Lyophilised:Reconstitute with 58 μl aqua dest
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SSHTLAVVGKVTPTPRPTDGVDIYFGMPGEISEHEGFLRA KMDLEERRMRQINEVMREWAMADNQSKNLPKADRQALN EHFQSILQTLEEQVSGERQRLVETHATRVIALINDQRR AALEGFLAALQADPPQAERVLLALRRYLRAEQKEQRHT LRHYQHVAAVDPEKAQQMRFQVHTHLQVIEERVNQSLGLL DQNPHLAQELRPQIQELLHSEHLGPSELEAPAPGGSSE DKGGLQPPDSKDADTPMTLPKGSTEQDAASPEKEKMNP LEQYERKVNASVPRGFPFHSSEIQRDELAPAGTGVSRE AVSGLLIMGAGGGSLIVLSMLLLRRKKPYGAISHGVVEVD PMLTLEEQQLRELQRHGYENPTYRFLEERP
Sequence Similarities: Belongs to the APP family.
Gene Name: APLP1 amyloid beta (A4) precursor-like protein 1 [ Homo sapiens ]
Official Symbol: APLP1
Synonyms: APLP1; amyloid beta (A4) precursor-like protein 1; amyloid-like protein 1; amyloid precursor like protein 1; amyloid like protein 1; APLP;
Gene ID: 333
mRNA Refseq: NM_001024807
Protein Refseq: NP_001019978
MIM: 104775
Uniprot ID: P51693
Chromosome Location: 19q
Function: alpha-2A adrenergic receptor binding; alpha-2B adrenergic receptor binding; alpha-2C adrenergic receptor binding; heparin binding; identical protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.