"APLP1" Related Products

Recombinant Human APLP1, His-tagged

Cat.No. : APLP1-26119TH
Product Overview : Recombinant fragment, corresponding to amino acids 274-651 of Human APLP1 with an N-terminal His tag; Predicted MWt 43 kDa.
Description : This gene encodes a member of the highly conserved amyloid precursor protein gene family. The encoded protein is a membrane-associated glycoprotein that is cleaved by secretases in a manner similar to amyloid beta A4 precursor protein cleavage. This cleavage liberates an intracellular cytoplasmic fragment that may act as a transcriptional activator. The encoded protein may also play a role in synaptic maturation during cortical development. Alternatively spliced transcript variants encoding different isoforms have been described.
Conjugation : HIS
Source : E. coli
Tissue specificity : Expressed in the cerebral cortex where it is localized to the postsynaptic density (PSD).
Form : Lyophilised:Reconstitute with 58 μl aqua dest
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SSHTLAVVGKVTPTPRPTDGVDIYFGMPGEISEHEGFLRA KMDLEERRMRQINEVMREWAMADNQSKNLPKADRQALN EHFQSILQTLEEQVSGERQRLVETHATRVIALINDQRR AALEGFLAALQADPPQAERVLLALRRYLRAEQKEQRHT LRHYQHVAAVDPEKAQQMRFQVHTHLQVIEERVNQSLGLL DQNPHLAQELRPQIQELLHSEHLGPSELEAPAPGGSSE DKGGLQPPDSKDADTPMTLPKGSTEQDAASPEKEKMNP LEQYERKVNASVPRGFPFHSSEIQRDELAPAGTGVSRE AVSGLLIMGAGGGSLIVLSMLLLRRKKPYGAISHGVVEVD PMLTLEEQQLRELQRHGYENPTYRFLEERP
Sequence Similarities : Belongs to the APP family.
Gene Name : APLP1 amyloid beta (A4) precursor-like protein 1 [ Homo sapiens ]
Official Symbol : APLP1
Synonyms : APLP1; amyloid beta (A4) precursor-like protein 1; amyloid-like protein 1; amyloid precursor like protein 1; amyloid like protein 1; APLP;
Gene ID : 333
mRNA Refseq : NM_001024807
Protein Refseq : NP_001019978
MIM : 104775
Uniprot ID : P51693
Chromosome Location : 19q
Function : alpha-2A adrenergic receptor binding; alpha-2B adrenergic receptor binding; alpha-2C adrenergic receptor binding; heparin binding; identical protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.