Recombinant Human APLP1, His-tagged
Cat.No. : | APLP1-26119TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 274-651 of Human APLP1 with an N-terminal His tag; Predicted MWt 43 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the highly conserved amyloid precursor protein gene family. The encoded protein is a membrane-associated glycoprotein that is cleaved by secretases in a manner similar to amyloid beta A4 precursor protein cleavage. This cleavage liberates an intracellular cytoplasmic fragment that may act as a transcriptional activator. The encoded protein may also play a role in synaptic maturation during cortical development. Alternatively spliced transcript variants encoding different isoforms have been described. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Expressed in the cerebral cortex where it is localized to the postsynaptic density (PSD). |
Form : | Lyophilised:Reconstitute with 58 μl aqua dest |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SSHTLAVVGKVTPTPRPTDGVDIYFGMPGEISEHEGFLRA KMDLEERRMRQINEVMREWAMADNQSKNLPKADRQALN EHFQSILQTLEEQVSGERQRLVETHATRVIALINDQRR AALEGFLAALQADPPQAERVLLALRRYLRAEQKEQRHT LRHYQHVAAVDPEKAQQMRFQVHTHLQVIEERVNQSLGLL DQNPHLAQELRPQIQELLHSEHLGPSELEAPAPGGSSE DKGGLQPPDSKDADTPMTLPKGSTEQDAASPEKEKMNP LEQYERKVNASVPRGFPFHSSEIQRDELAPAGTGVSRE AVSGLLIMGAGGGSLIVLSMLLLRRKKPYGAISHGVVEVD PMLTLEEQQLRELQRHGYENPTYRFLEERP |
Sequence Similarities : | Belongs to the APP family. |
Gene Name : | APLP1 amyloid beta (A4) precursor-like protein 1 [ Homo sapiens ] |
Official Symbol : | APLP1 |
Synonyms : | APLP1; amyloid beta (A4) precursor-like protein 1; amyloid-like protein 1; amyloid precursor like protein 1; amyloid like protein 1; APLP; |
Gene ID : | 333 |
mRNA Refseq : | NM_001024807 |
Protein Refseq : | NP_001019978 |
MIM : | 104775 |
Uniprot ID : | P51693 |
Chromosome Location : | 19q |
Function : | alpha-2A adrenergic receptor binding; alpha-2B adrenergic receptor binding; alpha-2C adrenergic receptor binding; heparin binding; identical protein binding; |
Products Types
◆ Recombinant Protein | ||
APLP1-394H | Recombinant Human APLP1 Protein, His-tagged | +Inquiry |
APLP1-1102H | Recombinant Human APLP1 protein(Met1-Glu580), His-tagged | +Inquiry |
Aplp1-295M | Recombinant Mouse Aplp1 Protein, His-tagged | +Inquiry |
APLP1-623M | Recombinant Mouse APLP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
APLP1-63H | Recombinant Human APLP1 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
APLP1-1031HCL | Recombinant Human APLP1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket