Recombinant Human APLP1 Protein, His-tagged
Cat.No. : | APLP1-63H |
Product Overview : | Recombinant Human Amyloid-like Protein 1 is produced by our Mammalian expression system and the target gene encoding Gly42-Pro212 is expressed with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | His |
Protein Length : | Gly42-Pro212 |
Description : | Amyloid-like protein 1 (APLP-1) is a member of the highly conserved amyloid precursor protein gene family. APLP1 is a membrane-associated glycoprotein that is cleaved by secretases in a manner similar to amyloid beta A4 precursor protein cleavage. APLP1, together with APLP2, are important modulators of glucose. APLP1 may also play a role in synaptic maturation during cortical development, and is genetically linked to Alzheimer'sdisease. |
Form : | Lyophilized from a 0.2 um filtered solution of PBS, 1mM EDTA, pH7.4. |
AA Sequence : | GGSPGAAEAPGSAQVAGLCGRLTLHRDLRTGRWEPDPQRSRRCLRDPQRVLEYCRQMYPELQIARV EQATQAIPMERWCGGSRSGSCAHPHHQVVPFRCLPGEFVSEALLVPEGCRFLHQERMDQCESSTRR HQEAQEACSSQGLILHGSGMLLPCGSDRFRGV EYVCCPPHHHHHH |
Endotoxin : | Less than 0.1 ng/ug (1 EU/ug). |
Purity : | >95% |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Quality Statement : | Purity: Greater than 95% as determined by reducing SDS-PAGE. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below. |
Gene Name | APLP1 amyloid beta precursor like protein 1 [ Homo sapiens (human) ] |
Official Symbol | APLP1 |
Synonyms | Amyloid-like protein 1; APLP; APLP-1; C30; APLP1 |
Gene ID | 333 |
mRNA Refseq | NM_005166.5 |
Protein Refseq | NP_005157.1 |
MIM | 104775 |
UniProt ID | P51693 |
◆ Recombinant Proteins | ||
APLP1-687H | Recombinant Human APLP1 protein, GST-tagged | +Inquiry |
APLP1-9745H | Recombinant Human APLP1 protein, GST-tagged | +Inquiry |
RFL-35884HF | Recombinant Full Length Human Amyloid-Like Protein 1(Aplp1) Protein, His-Tagged | +Inquiry |
APLP1-350H | Recombinant Human APLP1, His tagged | +Inquiry |
Aplp1-295M | Recombinant Mouse Aplp1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APLP1-1031HCL | Recombinant Human APLP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APLP1 Products
Required fields are marked with *
My Review for All APLP1 Products
Required fields are marked with *
0
Inquiry Basket