Recombinant Human APLP1 Protein, His-tagged

Cat.No. : APLP1-63H
Product Overview : Recombinant Human Amyloid-like Protein 1 is produced by our Mammalian expression system and the target gene encoding Gly42-Pro212 is expressed with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : His
Protein Length : Gly42-Pro212
Description : Amyloid-like protein 1 (APLP-1) is a member of the highly conserved amyloid precursor protein gene family. APLP1 is a membrane-associated glycoprotein that is cleaved by secretases in a manner similar to amyloid beta A4 precursor protein cleavage. APLP1, together with APLP2, are important modulators of glucose. APLP1 may also play a role in synaptic maturation during cortical development, and is genetically linked to Alzheimer'sdisease.
Form : Lyophilized from a 0.2 um filtered solution of PBS, 1mM EDTA, pH7.4.
AA Sequence : GGSPGAAEAPGSAQVAGLCGRLTLHRDLRTGRWEPDPQRSRRCLRDPQRVLEYCRQMYPELQIARV EQATQAIPMERWCGGSRSGSCAHPHHQVVPFRCLPGEFVSEALLVPEGCRFLHQERMDQCESSTRR HQEAQEACSSQGLILHGSGMLLPCGSDRFRGV EYVCCPPHHHHHH
Endotoxin : Less than 0.1 ng/ug (1 EU/ug).
Purity : >95%
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Quality Statement : Purity: Greater than 95% as determined by reducing SDS-PAGE.
Shipping : The product is shipped at ambient temperature.
Upon receipt, store it immediately at the temperature listed below.
Gene Name APLP1 amyloid beta precursor like protein 1 [ Homo sapiens (human) ]
Official Symbol APLP1
Synonyms Amyloid-like protein 1; APLP; APLP-1; C30; APLP1
Gene ID 333
mRNA Refseq NM_005166.5
Protein Refseq NP_005157.1
MIM 104775
UniProt ID P51693

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APLP1 Products

Required fields are marked with *

My Review for All APLP1 Products

Required fields are marked with *

0
cart-icon