Recombinant Human ARAP1, His-tagged

• Cat.No.: ARAP1-26993TH
• Product Overview: Recombinant fragment, corresponding to amino acids 757-1133 of Human ARAP1 with an N terminal His tag. Observed mwt: 44 kDa ; accession number: AAI40793.

Specification

• Description: The protein encoded by this gene contains SAM, ARF-GAP, RHO-GAP, ankyrin repeat, RAS-associating, and pleckstrin homology (PH) domains. In vitro, this protein displays RHO-GAP and phosphatidylinositol (3,4,5) trisphosphate (PIP3)-dependent ARF-GAP activity. The encoded protein associates with the Golgi, and the ARF-GAP activity mediates changes in the Golgi and the formation of filopodia. It is thought to regulate the cell-specific trafficking of a receptor protein involved in apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene.
• Conjugation: HIS
• Source: E. coli
• Tissue specificity: Detected in heart, skeletal muscle, spleen, kidney, liver, placenta, lung, peripheral blood leukocytes, adrenal gland, bone marrow, brain, lymph node, mammary gland, prostate, spinal cord, stomach, thyroid and trachea.
• Form: Lyophilised:Reconstitution with 143 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KVSRYRELLVRLPPVNRATVKALISHLYCVQCFSDTNQMN VHNLAIVFGPTLFQTDGQDYKAGRVVEDLINHYVVVFS VDEEELRKQREEITAIVKMRVAGTASGTQHAGDFICTV YLEEKKAETEQHIKVPASMTAEELTLEILDRRNVGIREKD YWTCFEVNEREEAERPLHFAEKVLPILHGLGTDSHLVV KKHQAMEAMLLYLASRVGDTKHGMMKFREDRSLLGLGL PSGGFHDRYFILNSSCLRLYKEVRSHRPEKEWPIKSLK VYLGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCCDTQME LREWFATFLFVQHDGLVWPSEPSRVSRAVPEVRLGSVS LIPLRGSENEMRRSVAAFTADPLSLLRNV
• Sequence Similarities: Contains 1 Arf-GAP domain.Contains 4 PH domains.Contains 1 Ras-associating domain.Contains 1 Rho-GAP domain.Contains 1 SAM (sterile alpha motif) domain.

Gene Information

• Gene Name: ARAP1 ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 [ Homo sapiens ]
• Official Symbol: ARAP1
• Synonyms: ARAP1; ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1; centaurin, delta 2 , CENTD2; arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1
• Gene ID: 116985
• mRNA Refseq: NM_001040118
• Protein Refseq: NP_001035207
• MIM: 606646
• Uniprot ID: Q96P48
• Chromosome Location: 11q13.3
• Pathway: Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Regulation of RhoA activity, organism-specific biosystem; Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem
• Function: ARF GTPase activator activity; Rho GTPase activator activity; metal ion binding; phosphatidylinositol-3,4,5-trisphosphate binding; protein binding