"ARAP1" Related Products

Expand

Recombinant Human ARAP1, His-tagged

Cat.No.: ARAP1-26993TH
Product Overview: Recombinant fragment, corresponding to amino acids 757-1133 of Human ARAP1 with an N terminal His tag. Observed mwt: 44 kDa ; accession number: AAI40793.
Description: The protein encoded by this gene contains SAM, ARF-GAP, RHO-GAP, ankyrin repeat, RAS-associating, and pleckstrin homology (PH) domains. In vitro, this protein displays RHO-GAP and phosphatidylinositol (3,4,5) trisphosphate (PIP3)-dependent ARF-GAP activity. The encoded protein associates with the Golgi, and the ARF-GAP activity mediates changes in the Golgi and the formation of filopodia. It is thought to regulate the cell-specific trafficking of a receptor protein involved in apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene.
Conjugation: HIS
Source: E. coli
Tissue specificity: Detected in heart, skeletal muscle, spleen, kidney, liver, placenta, lung, peripheral blood leukocytes, adrenal gland, bone marrow, brain, lymph node, mammary gland, prostate, spinal cord, stomach, thyroid and trachea.
Form: Lyophilised:Reconstitution with 143 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KVSRYRELLVRLPPVNRATVKALISHLYCVQCFSDTNQMN VHNLAIVFGPTLFQTDGQDYKAGRVVEDLINHYVVVFS VDEEELRKQREEITAIVKMRVAGTASGTQHAGDFICTV YLEEKKAETEQHIKVPASMTAEELTLEILDRRNVGIREKD YWTCFEVNEREEAERPLHFAEKVLPILHGLGTDSHLVV KKHQAMEAMLLYLASRVGDTKHGMMKFREDRSLLGLGL PSGGFHDRYFILNSSCLRLYKEVRSHRPEKEWPIKSLK VYLGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCCDTQME LREWFATFLFVQHDGLVWPSEPSRVSRAVPEVRLGSVS LIPLRGSENEMRRSVAAFTADPLSLLRNV
Sequence Similarities: Contains 1 Arf-GAP domain.Contains 4 PH domains.Contains 1 Ras-associating domain.Contains 1 Rho-GAP domain.Contains 1 SAM (sterile alpha motif) domain.
Gene Name: ARAP1 ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 [ Homo sapiens ]
Official Symbol: ARAP1
Synonyms: ARAP1; ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1; centaurin, delta 2 , CENTD2; arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1;
Gene ID: 116985
mRNA Refseq: NM_001040118
Protein Refseq: NP_001035207
MIM: 606646
Uniprot ID: Q96P48
Chromosome Location: 11q13.3
Pathway: Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Regulation of RhoA activity, organism-specific biosystem; Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem;
Function: ARF GTPase activator activity; Rho GTPase activator activity; metal ion binding; phosphatidylinositol-3,4,5-trisphosphate binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.