Recombinant Human ARAP1, His-tagged
Cat.No. : | ARAP1-26993TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 757-1133 of Human ARAP1 with an N terminal His tag. Observed mwt: 44 kDa ; accession number: AAI40793. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 757-1133 a.a. |
Description : | The protein encoded by this gene contains SAM, ARF-GAP, RHO-GAP, ankyrin repeat, RAS-associating, and pleckstrin homology (PH) domains. In vitro, this protein displays RHO-GAP and phosphatidylinositol (3,4,5) trisphosphate (PIP3)-dependent ARF-GAP activity. The encoded protein associates with the Golgi, and the ARF-GAP activity mediates changes in the Golgi and the formation of filopodia. It is thought to regulate the cell-specific trafficking of a receptor protein involved in apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Tissue specificity : | Detected in heart, skeletal muscle, spleen, kidney, liver, placenta, lung, peripheral blood leukocytes, adrenal gland, bone marrow, brain, lymph node, mammary gland, prostate, spinal cord, stomach, thyroid and trachea. |
Form : | Lyophilised:Reconstitution with 143 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KVSRYRELLVRLPPVNRATVKALISHLYCVQCFSDTNQMN VHNLAIVFGPTLFQTDGQDYKAGRVVEDLINHYVVVFS VDEEELRKQREEITAIVKMRVAGTASGTQHAGDFICTV YLEEKKAETEQHIKVPASMTAEELTLEILDRRNVGIREKD YWTCFEVNEREEAERPLHFAEKVLPILHGLGTDSHLVV KKHQAMEAMLLYLASRVGDTKHGMMKFREDRSLLGLGL PSGGFHDRYFILNSSCLRLYKEVRSHRPEKEWPIKSLK VYLGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCCDTQME LREWFATFLFVQHDGLVWPSEPSRVSRAVPEVRLGSVS LIPLRGSENEMRRSVAAFTADPLSLLRNV |
Sequence Similarities : | Contains 1 Arf-GAP domain.Contains 4 PH domains.Contains 1 Ras-associating domain.Contains 1 Rho-GAP domain.Contains 1 SAM (sterile alpha motif) domain. |
Gene Name | ARAP1 ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 [ Homo sapiens ] |
Official Symbol | ARAP1 |
Synonyms | ARAP1; ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1; centaurin, delta 2 , CENTD2; arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1; |
Gene ID | 116985 |
mRNA Refseq | NM_001040118 |
Protein Refseq | NP_001035207 |
MIM | 606646 |
Uniprot ID | Q96P48 |
Chromosome Location | 11q13.3 |
Pathway | Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Regulation of RhoA activity, organism-specific biosystem; Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem; |
Function | ARF GTPase activator activity; Rho GTPase activator activity; metal ion binding; phosphatidylinositol-3,4,5-trisphosphate binding; protein binding; |
◆ Recombinant Proteins | ||
ARAP1-1832M | Recombinant Mouse ARAP1 Protein | +Inquiry |
ARAP1-26993TH | Recombinant Human ARAP1, His-tagged | +Inquiry |
ARAP1-32H | Recombinant Human ARAP1 protein, GST-tagged | +Inquiry |
ARAP1-655M | Recombinant Mouse ARAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARAP1-337HCL | Recombinant Human ARAP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARAP1 Products
Required fields are marked with *
My Review for All ARAP1 Products
Required fields are marked with *
0
Inquiry Basket