"ARF3" Related Products

Expand

Recombinant Human ARF3, His-tagged

Cat.No. : ARF3-26994TH
Product Overview : Recombinant full length protein, of Human ARF3 with N terminal His tag; 201 amino acids, 22.8 kDa inclusive of tag.
Description : ADP-ribosylation factor 3 (ARF3) is a member of the human ARF gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D.The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6) and members of each class share a common gene organization. The ARF3 gene contains five exons and four introns.
Protein length : 181 amino acids
Conjugation : HIS
Molecular Weight : 22.800kDa inclusive of tags
Source : E. coli
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.02% DTT
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK
Sequence Similarities : Belongs to the small GTPase superfamily. Arf family.
Gene Name : ARF3 ADP-ribosylation factor 3 [ Homo sapiens ]
Official Symbol : ARF3
Synonyms : ARF3; ADP-ribosylation factor 3; small GTP binding protein;
Gene ID : 377
mRNA Refseq : NM_001659
Protein Refseq : NP_001650
MIM : 103190
Uniprot ID : P61204
Chromosome Location : 12q13
Function : GTP binding; GTPase activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.