Recombinant Human ARF3, His-tagged

Cat.No. : ARF3-26994TH
Product Overview : Recombinant full length protein, of Human ARF3 with N terminal His tag; 201 amino acids, 22.8 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 181 amino acids
Description : ADP-ribosylation factor 3 (ARF3) is a member of the human ARF gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D.The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6) and members of each class share a common gene organization. The ARF3 gene contains five exons and four introns.
Conjugation : HIS
Molecular Weight : 22.800kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.02% DTT
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK
Sequence Similarities : Belongs to the small GTPase superfamily. Arf family.
Gene Name ARF3 ADP-ribosylation factor 3 [ Homo sapiens ]
Official Symbol ARF3
Synonyms ARF3; ADP-ribosylation factor 3; small GTP binding protein;
Gene ID 377
mRNA Refseq NM_001659
Protein Refseq NP_001650
MIM 103190
Uniprot ID P61204
Chromosome Location 12q13
Function GTP binding; GTPase activity; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARF3 Products

Required fields are marked with *

My Review for All ARF3 Products

Required fields are marked with *

0
cart-icon
0
compare icon