Recombinant Human ARF3, His-tagged

• Cat.No.: ARF3-26994TH
• Product Overview: Recombinant full length protein, of Human ARF3 with N terminal His tag; 201 amino acids, 22.8 kDa inclusive of tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 181 amino acids
• Description: ADP-ribosylation factor 3 (ARF3) is a member of the human ARF gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D.The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6) and members of each class share a common gene organization. The ARF3 gene contains five exons and four introns.
• Conjugation: HIS
• Molecular Weight: 22.800kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.02% DTT
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK
• Sequence Similarities: Belongs to the small GTPase superfamily. Arf family.

Gene Information

• Gene Name: ARF3 ADP-ribosylation factor 3 [ Homo sapiens ]
• Official Symbol: ARF3
• Synonyms: ARF3; ADP-ribosylation factor 3; small GTP binding protein
• Gene ID: 377
• mRNA Refseq: NM_001659
• Protein Refseq: NP_001650
• MIM: 103190
• Uniprot ID: P61204
• Chromosome Location: 12q13
• Function: GTP binding; GTPase activity; nucleotide binding