Species : |
Human |
Source : |
E.coli |
Tag : |
His |
Protein Length : |
181 amino acids |
Description : |
ADP-ribosylation factor 3 (ARF3) is a member of the human ARF gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D.The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6) and members of each class share a common gene organization. The ARF3 gene contains five exons and four introns. |
Conjugation : |
HIS |
Molecular Weight : |
22.800kDa inclusive of tags |
Form : |
Liquid |
Purity : |
>95% by SDS-PAGE |
Storage buffer : |
pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.02% DTT |
Storage : |
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : |
MGSSHHHHHHSSGLVPRGSHMGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK |
Sequence Similarities : |
Belongs to the small GTPase superfamily. Arf family. |