"ARHGAP1" Related Products

Expand

Recombinant Human ARHGAP1

Cat.No. : ARHGAP1-26235TH
Product Overview : Recombinant fragment of Human ARHGAP1 with a N terminal proprietary tag; Predicted MWt 36.63 kDa.
Protein length : 100 amino acids
Molecular Weight : 36.630kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Ubiquitous.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GFLNIDESQRVPATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDHQGELFPSPDPSGL
Sequence Similarities : Contains 1 CRAL-TRIO domain.Contains 1 Rho-GAP domain.
Gene Name : ARHGAP1 Rho GTPase activating protein 1 [ Homo sapiens ]
Official Symbol : ARHGAP1
Synonyms : ARHGAP1; Rho GTPase activating protein 1; rho GTPase-activating protein 1; Cdc42GAP; CDC42GAP; p50rhoGAP; RhoGAP;
Gene ID : 392
mRNA Refseq : NM_004308
Protein Refseq : NP_004299
MIM : 602732
Uniprot ID : Q07960
Chromosome Location : 11p11.2
Pathway : Regulation of CDC42 activity, organism-specific biosystem; Regulation of RAC1 activity, organism-specific biosystem; Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by Rho GTPases, organism-specific biosystem;
Function : GTPase activator activity; Rac GTPase activator activity; Rho GTPase activator activity; SH3 domain binding; SH3/SH2 adaptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.